POTEJ

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041264

 

Antibody HPA041271

 

Antibody HPA042822

 

Antibody HPA043260

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041264 HPA041271 HPA042822 HPA043260 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

26 37 41 24 

Antigen sequence

PKANREKMTQIMFETFNTPAMYVAIQ
 
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
 
YDHSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRD
 
LKALQLNELTMDDDTAVLVIDNGS
 

Matching transcripts

POTEJ-001 - ENSP00000387176 [100%]
 POTEJ-001 - ENSP00000387176 [84%]
 POTEJ-001 - ENSP00000387176 [93%]
 POTEJ-001 - ENSP00000387176 [100%]
 

Other gene match

ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTC1 - ENSG00000159251 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
 ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTC1 - ENSG00000159251 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
 POTED - ENSG00000166351 [98%]
POTEC - ENSG00000183206 [98%]
POTEM - ENSG00000187537 [95%]
POTEE - ENSG00000188219 [95%]
POTEF - ENSG00000196604 [95%]
POTEI - ENSG00000196834 [93%]
POTEH - ENSG00000198062 [95%]
POTEG - ENSG00000222036 [95%]
POTEB2 - ENSG00000230031 [98%]
POTEB - ENSG00000233917 [98%]
BX072566.1 - ENSG00000237375 [100%]
 POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytopolasmic positivity in cells in seminiferus ducts and leydig cells.
More information
 Immunohistochemical staining of human breast shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1800 1:150 1:1000 1:800 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 37.1, 26.9, 23.8, 18.0, 16.8 121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 32.3, 26.9, 23.8, 21.8, 18.0, 16.8, 16.3, 14.5, 13.9, 13.0, 11.4, 11.0, 8.5 121.4, 121.3, 117.4, 66.4, 61.7, 61.2, 61.0, 57.1, 54.5, 54.4, 44.1, 43.1, 41.9, 36.5, 34.5, 34.2 121.4, 121.3, 117.4 

Antibody dilution

1:250 1:250 1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:6000 1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

    

Description

   Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & golgi apparatus.
More information
 

Antibody dilution

   1:125 

Validation IF

   Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
POTEJ-001