APOC4-APOC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055877

 

Antibody HPA062671

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055877 HPA062671 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

40 45 

Antigen sequence

TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
 
QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
 

Matching transcripts

APOC4-APOC2-001 - ENSP00000468139 [100%]
 APOC4-APOC2-002 - ENSP00000467185 [100%]
 

Other gene match

APOC2 - ENSG00000234906 [100%]
 APOC4 - ENSG00000267467 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human appendix shows positivity in plasma.
More information
 Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules along with distinctly stained extracellular material/ Plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:325 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

20.0, 11.3 14.6 

Antibody dilution

1:1320 1:370 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:10600 1:4500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
APOC4-APOC2-001
 
APOC4-APOC2-002