AC007952.5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048913

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA048913 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

52 

Antigen sequence

MAVSRMSKWRLSRVGGSRSLPAEMEVLGEVWCVRAEEQPMTGLGIVWHSP
LD
 

Matching transcripts

AC007952.5-001 - ENSP00000382044 [96%]
AC007952.5-002 - ENSP00000382042 [96%]
AC007952.5-201 - ENSP00000404934 [96%]
AC007952.5-202 - ENSP00000395460 [96%]
 

Other gene match

AC007952.6 - ENSG00000197665 [100%]
AC106017.1 - ENSG00000230493 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

18.1, 16.3, 16.2, 14.1, 12.3, 12.2 

Antibody dilution

1:460 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AC007952.5-001
 
AC007952.5-002
 
AC007952.5-201
 
AC007952.5-202