GAGE12F

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043232

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043232 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

37 

Antigen sequence

PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA
 

Matching transcripts

GAGE12F-001 - ENSP00000404123 [100%]
 

Other gene match

GAGE2A - ENSG00000189064 [100%]
GAGE2E - ENSG00000205775 [100%]
GAGE1 - ENSG00000205777 [100%]
GAGE12G - ENSG00000215269 [100%]
GAGE10 - ENSG00000215274 [97%]
GAGE12E - ENSG00000216649 [97%]
GAGE12J - ENSG00000224659 [100%]
GAGE12H - ENSG00000224902 [97%]
GAGE12D - ENSG00000227488 [97%]
GAGE2B - ENSG00000231850 [100%]
GAGE2C - ENSG00000236249 [100%]
GAGE13 - ENSG00000237597 [97%]
GAGE12C - ENSG00000237671 [97%]
GAGE2D - ENSG00000240257 [100%]
GAGE12I - ENSG00000241465 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:2500 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

15.6, 13.0, 12.9, 12.8, 12.7 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GAGE12F-001