AL137798.1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043267

 

Antibody HPA043292

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043267 HPA043292 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

26 60 

Antigen sequence

GQERRLIRSGSSQNESQEDQGADLIS
 
PSAHTSECFSTTACPVACILLVWNSQTPAGLQSLCTGRHPSLSARAQWAG
PRASREEGTF
 

Matching transcripts

AL137798.1-201 - ENSP00000408511 [92%]
 AL137798.1-201 - ENSP00000408511 [97%]
 

Other gene match

AL358813.2 - ENSG00000203815 [100%]
AL355149.2 - ENSG00000268674 [85%]
AL021920.2 - ENSG00000268991 [92%]
 AL358813.2 - ENSG00000203815 [100%]
AL355149.2 - ENSG00000268674 [88%]
AL021920.2 - ENSG00000268991 [97%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic and nuclear positivity in glial cells.
More information
 Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:50 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

  

Description

  

Target mass (kDa)

18.3 18.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
AL137798.1-201