HLA-DOB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013846

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA013846 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

141 

Antigen sequence

KADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALIKLGQPDAEQW
NSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQ
HNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGD
 

Matching transcripts

HLA-DOB-001 - ENSP00000390020 [99%]
HLA-DOB-004 - ENSP00000394860 [97%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lymph node shows strong nuclear and cytoplasmic positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

30.8, 20.7 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
HLA-DOB-001
 
HLA-DOB-004