CT45A5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044735

 

Antibody HPA044757

 

Antibody HPA046872

 

Antibody HPA046987

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044735 HPA044757 HPA046872 HPA046987 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

50 38 26 39 

Antigen sequence

TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
 
QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
 
KKLMTGHAIPPSQLDSQIDDFTGFSK
 
PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
 

Matching transcripts

CT45A5-002 - ENSP00000359759 [100%]
CT45A5-003 - ENSP00000425997 [100%]
CT45A5-004 - ENSP00000424778 [100%]
 CT45A5-002 - ENSP00000359759 [100%]
CT45A5-003 - ENSP00000425997 [100%]
CT45A5-004 - ENSP00000424778 [100%]
 CT45A5-002 - ENSP00000359759 [100%]
CT45A5-003 - ENSP00000425997 [100%]
CT45A5-004 - ENSP00000424778 [100%]
 CT45A5-002 - ENSP00000359759 [90%]
CT45A5-003 - ENSP00000425997 [90%]
CT45A5-004 - ENSP00000424778 [90%]
 

Other gene match

CT45A6 - ENSG00000226907 [100%]
CT45A4 - ENSG00000228836 [100%]
CT45A3 - ENSG00000232417 [100%]
CT45A1 - ENSG00000232478 [100%]
CT45A2 - ENSG00000242185 [100%]
 CT45A6 - ENSG00000226907 [100%]
CT45A4 - ENSG00000228836 [100%]
CT45A3 - ENSG00000232417 [100%]
CT45A1 - ENSG00000232478 [100%]
CT45A2 - ENSG00000242185 [100%]
 CT45A6 - ENSG00000226907 [100%]
CT45A4 - ENSG00000228836 [100%]
CT45A3 - ENSG00000232417 [100%]
CT45A1 - ENSG00000232478 [100%]
CT45A2 - ENSG00000242185 [100%]
 CT45A6 - ENSG00000226907 [97%]
CT45A4 - ENSG00000228836 [97%]
CT45A3 - ENSG00000232417 [100%]
CT45A1 - ENSG00000232478 [100%]
CT45A2 - ENSG00000242185 [97%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:150 1:25 1:450 

Literature conformity

No avaliable characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

    

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

21.3, 21.2, 21.1 21.3, 21.2, 21.1 21.3, 21.2, 21.1 21.3, 21.2, 21.1 

Antibody dilution

1:250 1:250 1:80 1:270 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CT45A5-002
 
CT45A5-003
 
CT45A5-004