BCKDHA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036640

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036640 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

93 

Antigen sequence

EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAER
KPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH
 

Matching transcripts

BCKDHA-001 - ENSP00000269980 [100%]
BCKDHA-002 - ENSP00000416000 [100%]
BCKDHA-201 - ENSP00000471150 [100%]
 

Other gene match

CTC-435M10.3 - ENSG00000255730 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong granular positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:450 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein chara 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.2, 50.8, 50.5 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
BCKDHA-001
 
BCKDHA-002
 
BCKDHA-201