LINC00696

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA061289

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA061289 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

71 

Antigen sequence

VLWKTEPFSLWACTAACPPSLSPTLLALGLPRDGKELAEQGSLWTVLEPG
GDWSHSQSQLGTPGRGKGALG
 

Matching transcripts

LINC00696-201 - ENSP00000437714 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

No avaliable characterization data 

RNA consistency

Not at all consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

16.9 

Antibody dilution

1:440 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LINC00696-201