LIMS3L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA058455

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA058455 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKV
Y
 

Matching transcripts

LIMS3L-001 - ENSP00000404432 [100%]
 

Other gene match

LIMS1 - ENSG00000169756 [100%]
LIMS3 - ENSG00000256977 [100%]
LIMS3 - ENSG00000257207 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

44.4, 28.1, 13.3 

Antibody dilution

1:200 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LIMS3L-001