CUX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003277

 

Antibody HPA003317

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003277 HPA003317 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

103 148 

Antigen sequence

LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEA
GASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDH
WWS
 
KSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQR
LHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQA
ETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
 

Matching transcripts

CUX1-004 - ENSP00000292535 [100%]
CUX1-005 - ENSP00000353401 [100%]
CUX1-006 - ENSP00000446630 [100%]
CUX1-007 - ENSP00000447373 [100%]
CUX1-008 - ENSP00000450125 [100%]
CUX1-009 - ENSP00000451558 [100%]
 CUX1-001 - ENSP00000292538 [100%]
CUX1-003 - ENSP00000414091 [100%]
CUX1-004 - ENSP00000292535 [100%]
CUX1-005 - ENSP00000353401 [100%]
CUX1-006 - ENSP00000446630 [100%]
CUX1-007 - ENSP00000447373 [100%]
CUX1-008 - ENSP00000450125 [100%]
CUX1-009 - ENSP00000451558 [100%]
CUX1-016 - ENSP00000377410 [100%]
CUX1-002 - ENSP00000449371 [97%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong cytopalsmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding dissimilar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding dissimilar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:43  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

165.7, 164.2, 161.6, 157.9, 153.4, 147.1 165.7, 164.2, 161.6, 157.9, 153.4, 147.1, 77.5, 77.2, 75.6, 72.8 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CUX1-001
 
CUX1-002
 
CUX1-003
 
CUX1-004
 
CUX1-005
 
CUX1-006
 
CUX1-007
 
CUX1-008
 
CUX1-009
 
CUX1-016