BCL2L2-PABPN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000637

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000637 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

143 

Antigen sequence

MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWY
 

Matching transcripts

BCL2L2-PABPN1-001 - ENSP00000451320 [100%]
BCL2L2-PABPN1-002 - ENSP00000452479 [100%]
 

Other gene match

PABPN1 - ENSG00000100836 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

None 

Antibody dilution

1:50 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.2, 32.7, 31.5, 20.2, 19.0 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BCL2L2-PABPN1-001
 
BCL2L2-PABPN1-002