GH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043715

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043715 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
 

Matching transcripts

GH1-001 - ENSP00000312673 [95%]
GH1-003 - ENSP00000408486 [95%]
GH1-004 - ENSP00000343791 [95%]
GH1-005 - ENSP00000339278 [95%]
 

Other gene match

GH2 - ENSG00000136487 [95%]
CSH1 - ENSG00000136488 [100%]
CSHL1 - ENSG00000204414 [98%]
CSH2 - ENSG00000213218 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1100 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

25.4, 25.0, 24.8, 23.1, 23.0, 20.2, 18.4, 18.2, 15.9, 14.9, 14.0, 13.9 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GH1-001
 
GH1-003
 
GH1-004
 
GH1-005