RP11-793H13.10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003384

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003384 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

133 

Antigen sequence

LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAK
MRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQ
PQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
 

Matching transcripts

RP11-793H13.10-001 - ENSP00000466174 [100%]
 

Other gene match

ATF7 - ENSG00000170653 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cervix, uterine shows moderate nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Liver
Lane 5: Tonsil
Lane 6:
More information
 

Target mass (kDa)

53.0, 51.8, 50.0, 49.6 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RP11-793H13.10-001