ADORA3 AD026 low adrenal gland glandular cells medium appendix glandular cells none appendix lymphoid tissue none bone marrow hematopoietic cells low breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells low cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells medium colon endothelial cells none colon glandular cells low colon peripheral nerve/ganglion low duodenum glandular cells low epididymis glandular cells none esophagus squamous epithelial cells medium fallopian tube glandular cells none gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules low lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes medium lung macrophages low lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells medium ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells low pancreas islets of Langerhans none parathyroid gland glandular cells none placenta decidual cells none placenta trophoblastic cells low prostate glandular cells none rectum glandular cells none salivary gland glandular cells low seminal vesicle glandular cells none skeletal muscle myocytes low skin fibroblasts none skin keratinocytes low skin Langerhans none skin melanocytes none small intestine glandular cells low smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 chondrocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells none stomach, upper glandular cells low testis cells in seminiferus ducts none testis Leydig cells medium thyroid gland glandular cells low tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells low urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium uncertain cytoplasm U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected GWNMKLTSEYHRNVTFLSCQFVSVMRMD uncertain adrenal gland glandular cells strong appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells moderate colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion moderate duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells strong fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells strong thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate negative uncertain uncertain RNKLSLNLSNSKETGAFYGREFKTAK uncertain adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells strong colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes moderate lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells negative salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes strong skin Langerhans weak skin melanocytes weak small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells strong vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells strong moderate weak liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells strong moderate stomach cancer tumor cells moderate negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells strong moderate negative uncertain U-251 MG uncertain moderate cytoplasm A-431 uncertain negative U-2 OS uncertain weak cytoplasm uncertain supportive KKFKETYLLILKACVVCHPSDSLDTSIEKNS uncertain adrenal gland glandular cells strong appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells strong bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells weak negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain supportive LTB4R2 BLT2 BLTR2 JULF2 NOP9 very low adrenal gland glandular cells low appendix glandular cells none appendix lymphoid tissue none bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells none breast myoepithelial cells high bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells low cerebral cortex endothelial cells none cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells none cervix, uterine squamous epithelial cells medium colon endothelial cells high colon glandular cells none duodenum glandular cells none epididymis glandular cells medium esophagus squamous epithelial cells high fallopian tube glandular cells high gallbladder glandular cells none heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells high kidney cells in glomeruli none kidney cells in tubules none lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells none liver hepatocytes high lung macrophages low lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells high ovary ovarian stroma cells medium pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells high placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells low salivary gland glandular cells low skeletal muscle myocytes medium skin fibroblasts low skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells low smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes high soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve medium soft tissue 2 adipocytes medium soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve low spleen cells in red pulp high spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells low testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells none tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells high urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma medium uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells low vagina squamous epithelial cells high vulva/anal skin epidermal cells high non-supportive nucleus but not nucleoli U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low uncertain adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells strong bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells negative duodenum glandular cells negative epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells negative heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes strong lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells strong placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells weak salivary gland glandular cells weak skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes strong soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp strong spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells strong vulva/anal skin epidermal cells strong breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells strong weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells moderate negative testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells moderate negative urothelial cancer tumor cells moderate weak negative non-supportive MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells strong vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells moderate weak negative glioma tumor cells negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate negative ovarian cancer tumor cells strong moderate negative pancreatic cancer tumor cells strong weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells weak negative non-supportive U-251 MG non-supportive weak nucleus but not nucleoli A-431 non-supportive weak nucleus but not nucleoli U-2 OS non-supportive weak nucleus but not nucleoli uncertain supportive P2RY1 P2Y1 low adrenal gland glandular cells low appendix glandular cells medium appendix lymphoid tissue none bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells low breast myoepithelial cells none bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil high cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells none colon endothelial cells low colon glandular cells high colon peripheral nerve/ganglion low duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells none gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells medium liver bile duct cells none liver hepatocytes high lung macrophages medium lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells low pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells medium placenta trophoblastic cells low prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts none skin keratinocytes medium skin Langerhans medium skin melanocytes none small intestine glandular cells high smooth muscle smooth muscle cells medium soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp low spleen cells in white pulp none stomach, lower glandular cells low stomach, upper glandular cells low testis cells in seminiferus ducts low testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells none tonsil non-germinal center cells low tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells medium uncertain CACO-2 Medium U-251 MG Low A-549 Low HeLa Low PC-3 Low RT-4 Low U-2 OS Low HEK 293 Low Hep-G2 Not detected MCF-7 Not detected A-431 Not detected MKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDT uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells strong bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts strong skin keratinocytes weak skin Langerhans moderate skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 fibroblasts strong soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive uncertain MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYY uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil strong cervix, uterine glandular cells moderate colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion weak duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes strong hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes strong lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells moderate placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes moderate skin Langerhans moderate skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate negative carcinoid tumor cells weak negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong weak negative endometrial cancer tumor cells negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate negative testis cancer tumor cells negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells weak negative non-supportive uncertain Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about