CSNK1E CKIE CKIepsilon HCKIE low adrenal gland glandular cells low appendix glandular cells medium appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes none breast glandular cells low breast myoepithelial cells none bronchus respiratory epithelial cells high cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells none cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil medium cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes none lung macrophages low lung pneumocytes none lymph node germinal center cells low lymph node non-germinal center cells low nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells low ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans none parathyroid gland glandular cells low placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes low skin Langerhans none skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes low soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells high testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells none tonsil non-germinal center cells low tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells medium vagina squamous epithelial cells low vulva/anal skin epidermal cells low uncertain cytoskeleton (intermediate filaments) cytoplasm U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer strong cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells strong colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells strong placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes moderate skin Langerhans negative skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate endometrial cancer tumor cells moderate weak glioma tumor cells strong moderate weak head and neck cancer tumor cells moderate liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak lymphoma tumor cells moderate weak melanoma tumor cells moderate weak ovarian cancer tumor cells moderate pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate weak non-supportive NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP uncertain adrenal gland glandular cells negative appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells strong liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells strong moderate weak carcinoid tumor cells strong moderate cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells strong moderate renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong moderate negative urothelial cancer tumor cells strong moderate negative uncertain U-251 MG uncertain weak cytoplasm A-431 uncertain strong cytoskeleton (intermediate filaments) U-2 OS uncertain weak cytoskeleton (intermediate filaments) supportive supportive VRK1 medium adrenal gland glandular cells low appendix glandular cells low appendix lymphoid tissue low bone marrow hematopoietic cells high breast adipocytes none breast glandular cells low breast myoepithelial cells low bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells low cervix, uterine squamous epithelial cells low colon endothelial cells none colon glandular cells none colon peripheral nerve/ganglion none duodenum glandular cells low epididymis glandular cells low esophagus squamous epithelial cells low fallopian tube glandular cells none gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli none kidney cells in tubules none lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes low lung macrophages low lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells low placenta trophoblastic cells medium prostate glandular cells none rectum glandular cells none salivary gland glandular cells none seminal vesicle glandular cells none skeletal muscle myocytes none skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells low smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp medium stomach, lower glandular cells low stomach, upper glandular cells low testis cells in seminiferus ducts high testis Leydig cells none thyroid gland glandular cells low tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells none urinary bladder urothelial cells low uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells none vulva/anal skin epidermal cells low high nucleus cytoplasm U-251 MG High CACO-2 High Hep-G2 High MCF-7 High PC-3 High RT-4 High A-431 High HEK 293 High A-549 Medium HeLa Medium U-2 OS Medium KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells negative salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells moderate weak negative lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells strong moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells strong moderate weak negative supportive U-251 MG supportive moderate nucleus but not nucleoli A-431 supportive moderate nucleus but not nucleoli cytoplasm U-2 OS supportive strong nucleus but not nucleoli cytoplasm supportive supportive LPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTR supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells negative epididymis glandular cells moderate esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts strong testis Leydig cells negative thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells weak tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells weak negative renal cancer tumor cells negative skin cancer tumor cells weak negative stomach cancer tumor cells weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells weak negative supportive U-251 MG supportive weak nucleus A-431 supportive strong nucleus nucleoli U-2 OS supportive moderate nucleus supportive supportive VRK2 low adrenal gland glandular cells low appendix glandular cells low appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells low cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells none colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion none duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells medium fallopian tube glandular cells low gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells low liver hepatocytes low lung macrophages medium lung pneumocytes medium lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells low ovary ovarian stroma cells none pancreas exocrine glandular cells high pancreas islets of Langerhans none parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes high skin fibroblasts medium skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells high soft tissue 1 adipocytes none soft tissue 1 chondrocytes low soft tissue 1 fibroblasts none soft tissue 2 adipocytes none soft tissue 2 chondrocytes low soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells none vulva/anal skin epidermal cells medium supportive cytoplasm endoplasmic reticulum CACO-2 High A-431 High U-2 OS High A-549 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium PC-3 Medium RT-4 Medium HEK 293 Medium U-251 MG Low uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells weak prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes negative skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts weak soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells strong weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative non-supportive KGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQ uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells negative oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes moderate skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells strong moderate negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative supportive U-2 OS supportive moderate endoplasmic reticulum CACO-2 supportive moderate cytoplasm A-431 supportive moderate endoplasmic reticulum non-supportive supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about