CATSPER2

uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells moderate pancreas exocrine glandular cells weak parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans strong skin melanocytes strong small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes strong soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate spleen cells in red pulp negative spleen cells in white pulp strong stomach, lower glandular cells weak stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate

non-supportive mitochondria nucleus but not nucleoli plasma membrane cytoplasm

CACO-2 Medium HeLa Medium HEK 293 Medium U-251 MG Low A-549 Low Hep-G2 Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low SESIGRLDWETLVHENLPGLMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLED

uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells moderate pancreas exocrine glandular cells weak parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans strong skin melanocytes strong small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes strong soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate spleen cells in red pulp negative spleen cells in white pulp strong stomach, lower glandular cells weak stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate carcinoid tumor cells strong moderate weak cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells moderate weak glioma tumor cells strong moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells strong moderate weak negative non-supportive U-251 MG non-supportive strong nucleus but not nucleoli cytoplasm mitochondria A-431 non-supportive strong plasma membrane mitochondria U-2 OS non-supportive strong plasma membrane mitochondria supportive supportive CATSPER4

uncertain adrenal gland glandular cells negative appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate

uncertain centrosome

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected GQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSGLLQEPLAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRD

uncertain adrenal gland glandular cells negative appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong negative urothelial cancer tumor cells moderate negative uncertain U-251 MG uncertain weak centrosome A-431 uncertain weak U-2 OS uncertain negative uncertain uncertain TPCN1 FLJ20612 KIAA1169 TPC1

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells negative prostate glandular cells strong rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells strong tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

uncertain

A-549 High CACO-2 High RT-4 High U-251 MG Medium Hep-G2 Medium HeLa Medium MCF-7 Medium PC-3 Medium A-431 Medium U-2 OS Medium HEK 293 Medium FKSLLLHKRTAIQHAYRLLISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRT

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells negative prostate glandular cells strong rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells strong tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive TPCN2 TPC2

supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells strong duodenum glandular cells strong epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate

A-549 Medium CACO-2 Medium HeLa Medium MCF-7 Medium RT-4 Medium U-251 MG Low Hep-G2 Low PC-3 Low A-431 Low U-2 OS Low HEK 293 Low QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF

supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells strong duodenum glandular cells strong epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells moderate negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells negative head and neck cancer tumor cells moderate negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells strong weak negative thyroid cancer tumor cells moderate negative urothelial cancer tumor cells strong moderate weak negative uncertain supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about