C3AR1 AZ3B C3AR

uncertain adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

U-251 MG Low U-2 OS Low A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative supportive C5AR1 C5A C5AR C5R1 CD88

low adrenal gland glandular cells none appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil high cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells low gallbladder glandular cells medium heart muscle myocytes none hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes none lung macrophages medium lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells none ovary ovarian stroma cells low pancreas exocrine glandular cells low pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells low placenta trophoblastic cells none prostate glandular cells low rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells none skeletal muscle myocytes none skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp none stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells none thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells none urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells medium

medium plasma membrane cytoplasm

A-549 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low U-251 MG Not detected CACO-2 Not detected

uncertain adrenal gland glandular cells negative appendix glandular cells moderate appendix lymphoid tissue weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil strong cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative duodenum glandular cells strong epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells weak pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells strong moderate negative endometrial cancer tumor cells moderate weak negative glioma tumor cells strong moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative supportive U-251 MG uncertain negative A-431 supportive moderate plasma membrane cytoplasm U-2 OS uncertain negative non-supportive QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

uncertain adrenal gland glandular cells moderate appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes weak small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells negative head and neck cancer tumor cells weak negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive CCBP2 CCR10 CCR9 CMKBR9 D6

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells strong prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

non-supportive cytoskeleton (microtubules)

U-251 MG Low CACO-2 Low Hep-G2 Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low A-549 Not detected HeLa Not detected QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells strong prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells negative non-supportive U-251 MG non-supportive weak cytoskeleton (microtubules) A-431 non-supportive weak cytoskeleton (microtubules) U-2 OS non-supportive moderate cytoskeleton (microtubules) supportive supportive CCR1 CD191 CKR-1 CMKBR1 MIP1aR SCYAR1

U-251 MG Low CACO-2 Low MCF-7 Low RT-4 Low A-431 Low A-549 Not detected Hep-G2 Not detected HeLa Not detected PC-3 Not detected U-2 OS Not detected HEK 293 Not detected CCR10 GPR2

uncertain adrenal gland glandular cells strong appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells moderate pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak

non-supportive nucleus but not nucleoli cytoplasm

U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low A-431 Low U-2 OS Low HEK 293 Low RT-4 Not detected

uncertain adrenal gland glandular cells strong appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells moderate pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells strong moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells weak negative non-supportive U-251 MG non-supportive weak nucleus but not nucleoli cytoplasm A-431 non-supportive weak nucleus but not nucleoli cytoplasm U-2 OS non-supportive weak nucleus but not nucleoli supportive CCR2 CC-CKR-2 CD192 CKR2 CMKBR2 FLJ78302 MCP-1-R

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells strong colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells moderate fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells negative salivary gland glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes strong skin Langerhans negative skin melanocytes strong small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells moderate vulva/anal skin epidermal cells strong

uncertain

U-251 MG Low A-431 Low A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected U-2 OS Not detected HEK 293 Not detected

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells strong colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells moderate fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells negative salivary gland glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes strong skin Langerhans negative skin melanocytes strong small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells moderate vulva/anal skin epidermal cells strong breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells weak negative glioma tumor cells strong moderate negative head and neck cancer tumor cells strong moderate negative liver cancer tumor cells weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells weak negative ovarian cancer tumor cells negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells weak negative renal cancer tumor cells negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells negative testis cancer tumor cells strong negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells strong moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain CCR3 CC-CKR-3 CD193 CKR3 CMKBR3

uncertain adrenal gland glandular cells strong appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells negative colon glandular cells weak duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells strong ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes moderate skin Langerhans moderate skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells strong vulva/anal skin epidermal cells strong

non-supportive cytoplasm cytoskeleton (microtubules)

MCF-7 Low RT-4 Low A-431 Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected PC-3 Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells strong appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells negative colon glandular cells weak duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells strong ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes moderate skin Langerhans moderate skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells strong vulva/anal skin epidermal cells strong breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells moderate negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells strong moderate negative lung cancer tumor cells weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells moderate weak negative skin cancer tumor cells strong weak negative stomach cancer tumor cells weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells weak negative non-supportive U-251 MG non-supportive weak cytoplasm A-431 non-supportive weak cytoplasm cytoskeleton (microtubules) U-2 OS non-supportive weak cytoplasm non-supportive CCR4 CC-CKR-4 CD194 ChemR13 CKR4 CMKBR4 k5-5

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells negative duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative

uncertain plasma membrane cytoplasm

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected LQIYSADTPSSSYTQSTMDHDLHDAL

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells negative duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells weak negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells weak negative uncertain U-251 MG supportive weak plasma membrane A-431 uncertain negative U-2 OS non-supportive weak cytoplasm non-supportive supportive CCR5 CC-CKR-5 CD195 CKR-5 CKR5 CMKBR5 IDDM22

RT-4 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected CCR6 BN-1 CD196 CKR-L3 CMKBR6 DCR2 DRY-6 GPR-CY4 GPR29 STRL22

medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue high bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells none bronchus respiratory epithelial cells low cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells medium cerebral cortex glial cells none cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion none duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells medium gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes none skin fibroblasts medium skin keratinocytes medium skin Langerhans low skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes low soft tissue 1 chondrocytes medium soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp high stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells none thyroid gland glandular cells low tonsil germinal center cells high tonsil non-germinal center cells high tonsil squamous epithelial cells low urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells low vulva/anal skin epidermal cells low

non-supportive golgi apparatus

Hep-G2 Medium CACO-2 Low HeLa Low U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected

supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue strong bone marrow hematopoietic cells strong breast adipocytes weak breast glandular cells strong breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells negative liver bile duct cells strong liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative spleen cells in red pulp strong spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells strong moderate weak skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong moderate negative urothelial cancer tumor cells strong moderate weak supportive KYNTQGSDVCEPKYQTVSEPIRWKLLML

supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli strong kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans moderate parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative breast cancer tumor cells strong moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells moderate negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate weak negative non-supportive U-251 MG non-supportive moderate golgi apparatus U-2 OS non-supportive moderate golgi apparatus A-431 non-supportive moderate golgi apparatus supportive supportive CCR7 BLR2 CD197 CDw197 CMKBR7 EBI1

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion moderate duodenum glandular cells negative epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes strong lymph node germinal center cells negative lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells strong tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate

uncertain

A-549 Low CACO-2 Low Hep-G2 Low MCF-7 Low RT-4 Low U-2 OS Low U-251 MG Not detected HeLa Not detected PC-3 Not detected A-431 Not detected HEK 293 Not detected

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion moderate duodenum glandular cells negative epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes strong lymph node germinal center cells negative lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells strong tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells strong moderate negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells strong moderate weak melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative non-supportive CCR8 CDw198 CKR-L1 CMKBR8 CMKBRL2 CY6 GPR-CY6 TER1

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected CCR9 CDw199 GPR-9-6 GPR28

uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells strong breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells strong liver hepatocytes strong lung macrophages strong lung pneumocytes strong lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary ovarian stroma cells strong pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells strong placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve strong soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells weak thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells strong vagina squamous epithelial cells strong vulva/anal skin epidermal cells weak

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells strong breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells strong liver hepatocytes strong lung macrophages strong lung pneumocytes strong lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary ovarian stroma cells strong pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells strong placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve strong soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells weak thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells strong vagina squamous epithelial cells strong vulva/anal skin epidermal cells weak breast cancer tumor cells strong carcinoid tumor cells strong moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate weak glioma tumor cells strong moderate weak head and neck cancer tumor cells strong moderate weak liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong weak pancreatic cancer tumor cells strong weak prostate cancer tumor cells strong moderate renal cancer tumor cells strong moderate weak skin cancer tumor cells strong moderate negative stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong urothelial cancer tumor cells strong moderate weak supportive CCRL1 CCBP2 CCR11 CCX-CKR PPR1 VSHK1

CACO-2 Low HeLa Low PC-3 Low A-431 Low U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected Hep-G2 Not detected MCF-7 Not detected RT-4 Not detected CCRL2 CKRX CRAM-A CRAM-B HCR

uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells strong duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells strong thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

uncertain

PC-3 Medium RT-4 Medium U-251 MG Low CACO-2 Low A-431 Low U-2 OS Low A-549 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected HEK 293 Not detected FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells strong duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells strong thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells strong moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate negative thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive supportive CX3CR1 CCRL1 CMKBRL1 CMKDR1 GPR13 V28

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

MCF-7 Low HEK 293 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative non-supportive CXCR1 CD181 CDw128a CKR-1 CMKAR1 IL8RA

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected CXCR2 CD182 CMKAR2 IL8RB

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells negative gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells moderate lateral ventricle neuronal cells strong liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells weak seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak

uncertain

RT-4 Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells negative gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells moderate lateral ventricle neuronal cells strong liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells weak seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells negative carcinoid tumor cells strong weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells strong negative endometrial cancer tumor cells negative glioma tumor cells moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells weak negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain CXCR3 CD183 CKR-L2 CMKAR3 GPR9 IP10-R MigR

uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes moderate skin fibroblasts strong skin keratinocytes moderate skin Langerhans strong skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts strong soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes weak soft tissue 2 fibroblasts strong soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak

non-supportive cytoplasm

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes moderate skin fibroblasts strong skin keratinocytes moderate skin Langerhans strong skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts strong soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes weak soft tissue 2 fibroblasts strong soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak stomach cancer tumor cells strong moderate testis cancer tumor cells strong moderate thyroid cancer tumor cells strong urothelial cancer tumor cells moderate weak non-supportive U-251 MG non-supportive moderate cytoplasm A-431 non-supportive weak cytoplasm U-2 OS non-supportive moderate cytoplasm supportive CXCR4 CD184 D2S201E fusin HM89 HSY3RR LESTR NPY3R NPYR NPYY3R

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells strong breast myoepithelial cells moderate bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate

HeLa High HEK 293 Medium U-251 MG Low A-549 Low CACO-2 Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low Hep-G2 Not detected

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells strong breast myoepithelial cells moderate bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells moderate endometrial cancer tumor cells moderate weak glioma tumor cells weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate weak negative skin cancer tumor cells moderate weak stomach cancer tumor cells moderate testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells strong moderate weak negative supportive CXCR5 BLR1 CD185 MDR15

uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells negative epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages strong lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes moderate skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve moderate spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

uncertain

U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected

uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells negative epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages strong lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes moderate skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve moderate spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate negative carcinoid tumor cells strong weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate negative pancreatic cancer tumor cells strong weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong moderate weak negative urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative non-supportive CXCR6 BONZO CD186 STRL33 TYMSTR

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

U-251 MG Low CACO-2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low A-549 Not detected Hep-G2 Not detected HEK 293 Not detected EHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLP

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative supportive uncertain CXCR7 CMKOR1 GPR159 RDC1

uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells weak colon glandular cells weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

HeLa High MCF-7 High RT-4 High U-2 OS Medium CACO-2 Low PC-3 Low U-251 MG Not detected A-549 Not detected Hep-G2 Not detected A-431 Not detected HEK 293 Not detected LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY

uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells weak colon glandular cells weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate weak negative uncertain supportive DARC CCBP1 CD234 Dfy FY GPD

high adrenal gland glandular cells none appendix glandular cells none appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells high colon glandular cells none colon peripheral nerve/ganglion none duodenum glandular cells none epididymis glandular cells none esophagus squamous epithelial cells none fallopian tube glandular cells none gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules low lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes low lung macrophages none lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans none parathyroid gland glandular cells none placenta decidual cells none placenta trophoblastic cells none prostate glandular cells none rectum glandular cells none salivary gland glandular cells none seminal vesicle glandular cells none skeletal muscle myocytes none skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells none smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells none stomach, upper glandular cells none testis cells in seminiferus ducts none testis Leydig cells none thyroid gland glandular cells none tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells none

uncertain vesicles cell junctions

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected CHQATRTLLPSLPLPEGWSSHLDTLGSKS

supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain supportive GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS

supportive adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells strong colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp weak stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain weak vesicles A-431 uncertain strong vesicles U-2 OS uncertain strong vesicles cell junctions uncertain supportive FPR1 FMLP FPR

U-251 MG Low U-2 OS Low A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected FPR2 ALXR FMLP-R-II FMLPX FPR2A FPRH2 FPRL1 HM63 LXA4R

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells strong salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

uncertain

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected DTYCTFNFASWGGTPEERLKVAITMLTARG

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells strong salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells moderate negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells strong weak negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells moderate weak negative skin cancer tumor cells negative stomach cancer tumor cells strong negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain weak uncertain uncertain FPR3 FMLPY FPRH1 FPRL2 RMLP-R-I

RT-4 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected GPR77 C5L2

supportive adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil strong cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

uncertain

MCF-7 Medium HeLa Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected NDSVSYEYGDYSDLSDRPVDCLDGACLAIDPLR

supportive adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil strong cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate negative glioma tumor cells negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive supportive XCR1 CCXCR1 GPR5

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells strong colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages strong lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

uncertain

CACO-2 Low RT-4 Low U-251 MG Not detected A-549 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected MESSGNPESTTFFYYDLQSQPCENQAWVFATLA

uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells strong colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages strong lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells moderate placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate negative head and neck cancer tumor cells moderate negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about