C5AR1 C5A C5AR C5R1 CD88 low adrenal gland glandular cells none appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil high cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells low gallbladder glandular cells medium heart muscle myocytes none hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes none lung macrophages medium lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells none ovary ovarian stroma cells low pancreas exocrine glandular cells low pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells low placenta trophoblastic cells none prostate glandular cells low rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells none skeletal muscle myocytes none skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp none stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells none thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells none urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells medium medium plasma membrane cytoplasm A-549 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low U-251 MG Not detected CACO-2 Not detected uncertain adrenal gland glandular cells negative appendix glandular cells moderate appendix lymphoid tissue weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil strong cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative duodenum glandular cells strong epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells weak pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells strong moderate negative endometrial cancer tumor cells moderate weak negative glioma tumor cells strong moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative supportive U-251 MG uncertain negative A-431 supportive moderate plasma membrane cytoplasm U-2 OS uncertain negative non-supportive QGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV uncertain adrenal gland glandular cells moderate appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes weak small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp strong spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells negative head and neck cancer tumor cells weak negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive CCR6 BN-1 CD196 CKR-L3 CMKBR6 DCR2 DRY-6 GPR-CY4 GPR29 STRL22 medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue high bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells none bronchus respiratory epithelial cells low cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells medium cerebral cortex glial cells none cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion none duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells medium gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes none skin fibroblasts medium skin keratinocytes medium skin Langerhans low skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes low soft tissue 1 chondrocytes medium soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp high stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells none thyroid gland glandular cells low tonsil germinal center cells high tonsil non-germinal center cells high tonsil squamous epithelial cells low urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells low vulva/anal skin epidermal cells low non-supportive golgi apparatus Hep-G2 Medium CACO-2 Low HeLa Low U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue strong bone marrow hematopoietic cells strong breast adipocytes weak breast glandular cells strong breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells negative liver bile duct cells strong liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative spleen cells in red pulp strong spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells strong moderate weak skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong moderate negative urothelial cancer tumor cells strong moderate weak supportive KYNTQGSDVCEPKYQTVSEPIRWKLLML supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli strong kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans moderate parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative breast cancer tumor cells strong moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells moderate negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate weak negative non-supportive U-251 MG non-supportive moderate golgi apparatus U-2 OS non-supportive moderate golgi apparatus A-431 non-supportive moderate golgi apparatus supportive supportive DARC CCBP1 CD234 Dfy FY GPD high adrenal gland glandular cells none appendix glandular cells none appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells high colon glandular cells none colon peripheral nerve/ganglion none duodenum glandular cells none epididymis glandular cells none esophagus squamous epithelial cells none fallopian tube glandular cells none gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules low lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes low lung macrophages none lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans none parathyroid gland glandular cells none placenta decidual cells none placenta trophoblastic cells none prostate glandular cells none rectum glandular cells none salivary gland glandular cells none seminal vesicle glandular cells none skeletal muscle myocytes none skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells none smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells none stomach, upper glandular cells none testis cells in seminiferus ducts none testis Leydig cells none thyroid gland glandular cells none tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells none uncertain vesicles cell junctions U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected CHQATRTLLPSLPLPEGWSSHLDTLGSKS supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain supportive GNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS supportive adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells strong colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp weak stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain weak vesicles A-431 uncertain strong vesicles U-2 OS uncertain strong vesicles cell junctions uncertain supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about