CNGA1 CNCG CNCG1 CNG1 RCNC1 RCNCa

CACO-2 Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected Hep-G2 Not detected HeLa Not detected CNGA2 CNCA CNCA1 CNG2 FLJ46312 OCNC1 OCNCa OCNCALPHA

uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes weak lung macrophages strong lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans moderate parathyroid gland glandular cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

uncertain nucleus nucleoli cytoplasm

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected EAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSP

uncertain adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes weak lung macrophages strong lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans moderate parathyroid gland glandular cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells negative skin cancer tumor cells weak negative stomach cancer tumor cells weak negative testis cancer tumor cells strong negative thyroid cancer tumor cells negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain weak nucleoli nucleus but not nucleoli cytoplasm A-431 uncertain weak nucleus nucleoli cytoplasm U-2 OS uncertain moderate nucleus nucleoli supportive uncertain CNGA3 ACHM2 CCNC1 CCNCa CNCG3 CNG3

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected CNGA4 CNCA2 CNG5 CNGB2 OCNC2 OCNCb

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected CNGB3 ACHM3

RT-4 Low A-431 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected U-2 OS Not detected HEK 293 Not detected HCN1 BCNG-1 BCNG1 HAC-2

supportive adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages weak lung pneumocytes weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected PSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVTLFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAE

supportive adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages weak lung pneumocytes weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells weak negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells weak negative uncertain supportive HCN2 BCNG-2 BCNG2 HAC-1

A-549 Medium HeLa Medium MCF-7 Medium HEK 293 Medium U-251 MG Low CACO-2 Low Hep-G2 Low PC-3 Low RT-4 Low U-2 OS Low A-431 Not detected HCN3 KIAA1535

uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells strong duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes weak lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

uncertain

HeLa Medium MCF-7 Medium U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low LPLSPDSPATLLARSAWRSAGSPASPLVPVRAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLPQRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLS

uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells strong duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes weak lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells negative skin cancer tumor cells weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain weak non-supportive supportive HCN4

U-251 MG Low A-549 Low CACO-2 Low MCF-7 Low U-2 OS Low HEK 293 Low Hep-G2 Not detected HeLa Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about