LPHN3 KIAA0768 LEC3

medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells medium liver hepatocytes medium lung macrophages high lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells high ovary follicle cells low ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells high placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve medium soft tissue 2 adipocytes low soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells high

very low nucleus but not nucleoli cytoplasm nuclear membrane

U-2 OS Medium HEK 293 Medium U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low HeLa Low PC-3 Low RT-4 Low MCF-7 Not detected A-431 Not detected LCLAPDGIWDPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLN

uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells strong placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes moderate skin Langerhans negative skin melanocytes strong small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells strong breast cancer tumor cells strong moderate carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells strong moderate negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive

uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells negative breast adipocytes moderate breast glandular cells weak breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer strong cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells weak fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells strong liver bile duct cells negative liver hepatocytes moderate lung macrophages strong lung pneumocytes strong lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts strong soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak glioma tumor cells strong moderate weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak prostate cancer tumor cells strong moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate weak negative non-supportive U-251 MG non-supportive moderate nuclear membrane cytoplasm A-431 non-supportive moderate cytoplasm U-2 OS non-supportive moderate cytoplasm supportive DNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDMTTHLPSASSQIPALEESCEAVEAREIMWFKTRQGQIAKQPCP

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer strong cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes weak hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli strong kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve strong spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative breast cancer tumor cells strong moderate weak carcinoid tumor cells strong moderate cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells moderate weak head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak lymphoma tumor cells moderate weak melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells strong moderate renal cancer tumor cells moderate weak skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak supportive uncertain PTH1R PTHR PTHR1

low adrenal gland glandular cells high appendix glandular cells medium appendix lymphoid tissue none bone marrow hematopoietic cells high breast adipocytes none breast glandular cells high breast myoepithelial cells medium bronchus respiratory epithelial cells high cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells high cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells high cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells high fallopian tube glandular cells medium gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells high kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells none liver hepatocytes low lung macrophages medium lung pneumocytes medium lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells high pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells high prostate glandular cells medium rectum glandular cells high salivary gland glandular cells high seminal vesicle glandular cells medium skeletal muscle myocytes medium skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes medium soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve none soft tissue 2 adipocytes medium soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve low spleen cells in red pulp medium spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells high testis cells in seminiferus ducts medium testis Leydig cells high thyroid gland glandular cells high tonsil germinal center cells low tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells low vagina squamous epithelial cells medium vulva/anal skin epidermal cells high

uncertain golgi apparatus nuclear membrane

A-549 Low CACO-2 Low U-2 OS Low U-251 MG Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ

uncertain adrenal gland glandular cells moderate appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells strong gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells moderate liver hepatocytes weak lung macrophages strong lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak parathyroid gland glandular cells negative placenta decidual cells strong placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 2 adipocytes negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells strong weak carcinoid tumor cells weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells strong weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate uncertain U-251 MG uncertain weak nuclear membrane golgi apparatus A-431 uncertain moderate golgi apparatus U-2 OS uncertain weak nuclear membrane golgi apparatus supportive supportive

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells strong breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells strong kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells strong breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells moderate weak renal cancer tumor cells strong moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate weak testis cancer tumor cells moderate weak thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells moderate weak supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about