KCNJ5 CIR GIRK4 KATP1 Kir3.4 LQT13

medium adrenal gland glandular cells high appendix glandular cells medium appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells low cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells none colon endothelial cells none colon glandular cells medium colon peripheral nerve/ganglion none duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli none kidney cells in tubules high lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes medium lung macrophages medium lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells none ovary follicle cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells high pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes none skin fibroblasts low skin keratinocytes low skin Langerhans none skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes low soft tissue 1 fibroblasts low soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells none urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells none vulva/anal skin epidermal cells none

uncertain mitochondria

U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG

uncertain adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes moderate small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells strong moderate negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative supportive supportive VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary follicle cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes negative skin Langerhans negative skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells strong moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain weak mitochondria U-2 OS uncertain weak mitochondria supportive supportive

uncertain adrenal gland glandular cells strong appendix glandular cells weak appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes moderate breast glandular cells strong breast myoepithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells moderate colon endothelial cells moderate colon glandular cells weak colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells weak stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak glioma tumor cells moderate weak head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak non-supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about