NEK1 KIAA1901 NY-REN-55 medium adrenal gland glandular cells high appendix glandular cells high appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells medium cerebral cortex endothelial cells medium cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells high duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules high lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells medium liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary follicle cells medium ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes medium skin fibroblasts low skin keratinocytes medium skin Langerhans low skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells medium soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 chondrocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp low stomach, lower glandular cells high stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells high thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells high urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium supportive nuclear membrane nucleoli U-251 MG Medium HeLa Medium PC-3 Medium RT-4 Medium U-2 OS Medium HEK 293 Medium A-549 Low CACO-2 Low Hep-G2 Low MCF-7 Low A-431 Low NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells strong duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells strong placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong carcinoid tumor cells strong moderate cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells strong pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate weak stomach cancer tumor cells strong moderate testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate non-supportive supportive VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells moderate colon endothelial cells weak colon glandular cells strong duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells strong liver bile duct cells strong liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary follicle cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells strong weak negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells strong negative liver cancer tumor cells strong moderate negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate negative prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate supportive U-251 MG supportive moderate nuclear membrane A-431 supportive weak nuclear membrane U-2 OS supportive strong nucleoli nuclear membrane non-supportive supportive NEK3 HSPK36 MGC29949 medium adrenal gland glandular cells low appendix glandular cells low appendix lymphoid tissue none bone marrow hematopoietic cells low breast adipocytes low breast glandular cells none breast myoepithelial cells low bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells low cerebral cortex endothelial cells high cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells low colon endothelial cells high colon glandular cells medium colon peripheral nerve/ganglion none duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes high hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli medium kidney cells in tubules high lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes low lung macrophages none lung pneumocytes medium lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells medium pancreas exocrine glandular cells low pancreas islets of Langerhans none parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes high skin fibroblasts medium skin keratinocytes low skin Langerhans none skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells high soft tissue 1 adipocytes low soft tissue 1 chondrocytes low soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve none soft tissue 2 adipocytes medium soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells medium Hep-G2 High U-251 MG Medium CACO-2 Medium MCF-7 Medium HEK 293 Medium A-549 Low HeLa Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV supportive adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes weak breast glandular cells negative breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells strong cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells strong colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells weak fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung macrophages negative lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells weak ovary ovarian stroma cells moderate pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes weak soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells strong weak negative carcinoid tumor cells strong weak negative cervical cancer tumor cells strong weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells weak negative supportive supportive RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes moderate breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells strong colon glandular cells strong colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes weak skin Langerhans moderate skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes strong soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve strong spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells strong moderate negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak negative glioma tumor cells strong moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells strong moderate negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative supportive supportive NEK7 medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes none breast glandular cells low breast myoepithelial cells none bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells none cerebral cortex glial cells medium cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells low colon glandular cells low colon peripheral nerve/ganglion medium duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes medium lung macrophages medium lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes high skin fibroblasts medium skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes none soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve none soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve none spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells high stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells low tonsil germinal center cells none tonsil non-germinal center cells low tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells none vulva/anal skin epidermal cells none medium nucleus but not nucleoli cytoplasm U-251 MG High HeLa High A-431 High U-2 OS High HEK 293 High A-549 Medium CACO-2 Medium Hep-G2 Medium MCF-7 Medium PC-3 Medium RT-4 Medium MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells strong hippocampus neuronal cells strong kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells strong lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells negative seminal vesicle glandular cells strong skeletal muscle myocytes strong skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes weak soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells weak tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells strong weak cervical cancer tumor cells weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells weak negative glioma tumor cells strong moderate weak head and neck cancer tumor cells negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells strong moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate negative urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain weak nucleus but not nucleoli cytoplasm A-431 uncertain weak U-2 OS uncertain negative supportive supportive VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast glandular cells weak breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes strong lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells strong seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate negative lung cancer tumor cells moderate negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells strong weak negative uncertain U-251 MG uncertain moderate nucleus but not nucleoli A-431 uncertain moderate nucleus but not nucleoli U-2 OS uncertain negative non-supportive supportive NEK8 NPHP9 low adrenal gland glandular cells medium appendix glandular cells low appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells medium cerebral cortex glial cells medium cerebral cortex neuronal cells medium cerebral cortex neuropil medium cervix, uterine glandular cells low colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes low hippocampus glial cells none hippocampus neuronal cells medium kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells medium salivary gland glandular cells low skeletal muscle myocytes low skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 fibroblasts none soft tissue 2 adipocytes low soft tissue 2 fibroblasts none spleen cells in red pulp low spleen cells in white pulp none stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells medium low cytoskeleton (microtubules) nucleus but not nucleoli U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low QPQPQFISRFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHGSLTDISQPTIVEALLGYEMVQVA uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 fibroblasts weak soft tissue 2 adipocytes weak spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak negative testis cancer tumor cells strong moderate thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak uncertain U-251 MG uncertain negative A-431 uncertain weak U-2 OS uncertain negative uncertain supportive LSTERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQEAQRVVCGIDSSMILTVPGQALACGSNRFNKLG uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells negative colon endothelial cells moderate colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells strong weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate negative lung cancer tumor cells weak negative lymphoma tumor cells moderate negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain moderate nucleus but not nucleoli cytoskeleton (microtubules) A-431 uncertain moderate nucleus but not nucleoli cytoskeleton (microtubules) U-2 OS uncertain strong nucleus but not nucleoli cytoskeleton (microtubules) supportive supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about