OPN3 ECPN encephalopsin ERO NMO-1

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans negative skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

A-549 High U-251 MG Medium Hep-G2 Medium HeLa Medium PC-3 Medium RT-4 Medium A-431 Medium U-2 OS Medium CACO-2 Low MCF-7 Low HEK 293 Low

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans negative skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative supportive OPN4 melanopsin MOP

supportive adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected PKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEV

supportive adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells weak negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells moderate negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain uncertain RRH peropsin

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes moderate lung macrophages strong lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells strong seminal vesicle glandular cells moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate

uncertain golgi apparatus

U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HVTLSIKHHTTSDCTESLNRDWSDQIDVTKMS

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes moderate lung macrophages strong lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells strong seminal vesicle glandular cells moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells strong moderate renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells strong moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain weak golgi apparatus U-2 OS uncertain negative uncertain supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about