MAP2K1 MAPKK1 MEK1 PRKMK1 medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue medium bone marrow hematopoietic cells low breast adipocytes none breast glandular cells low breast myoepithelial cells none bronchus respiratory epithelial cells low cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil medium cervix, uterine squamous epithelial cells none colon endothelial cells low colon glandular cells low colon peripheral nerve/ganglion medium duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells low fallopian tube glandular cells low gallbladder glandular cells medium heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules low lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes low lung macrophages medium lung pneumocytes none lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells none placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells low high plasma membrane cytoplasm U-251 MG High A-549 High CACO-2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High Hep-G2 Medium uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells weak cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine glandular cells moderate colon endothelial cells negative colon glandular cells weak duodenum glandular cells weak epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes negative lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells weak salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans moderate skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes weak soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells strong tonsil non-germinal center cells moderate tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells moderate colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells moderate weak negative glioma tumor cells strong moderate weak head and neck cancer tumor cells strong weak liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells strong moderate weak melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells strong moderate renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate weak supportive U-251 MG supportive weak cytoplasm A-431 supportive weak cytoplasm U-2 OS supportive weak cytoplasm supportive MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve weak spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak carcinoid tumor cells moderate cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells weak negative lung cancer tumor cells negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate negative ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative supportive U-251 MG supportive weak plasma membrane cytoplasm A-431 supportive weak plasma membrane cytoplasm U-2 OS supportive weak plasma membrane cytoplasm supportive supportive MAP2K3 MAPKK3 MEK3 MKK3 PRKMK3 medium adrenal gland glandular cells low appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer none cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells none cerebral cortex neuronal cells medium cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells none colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells medium kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells none liver hepatocytes none lung macrophages low lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes high skin fibroblasts none skin keratinocytes low skin Langerhans low skin melanocytes none small intestine glandular cells medium smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve medium soft tissue 2 adipocytes none soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve none spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts none testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells none vulva/anal skin epidermal cells medium U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High supportive adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate weak negative supportive MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes strong skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain supportive MAP2K5 HsT17454 MAPKK5 MEK5 PRKMK5 medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer low cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells medium cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells low cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells medium hippocampus neuronal cells medium kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes low lung macrophages medium lung pneumocytes low lymph node germinal center cells low lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells low skeletal muscle myocytes high skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes medium soft tissue 1 fibroblasts medium soft tissue 2 adipocytes low soft tissue 2 fibroblasts low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells medium tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells medium low nucleoli cytoskeleton (microtubules) U-251 MG Medium A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium PC-3 Medium RT-4 Medium A-431 Medium U-2 OS Medium HEK 293 Medium uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells weak fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells strong lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans moderate skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts strong soft tissue 2 adipocytes strong soft tissue 2 fibroblasts weak spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak head and neck cancer tumor cells moderate liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells strong urothelial cancer tumor cells moderate weak negative supportive LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNA supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells negative bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes strong skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells negative thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells weak negative lung cancer tumor cells moderate negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain strong nucleoli cytoskeleton (microtubules) A-431 uncertain strong nucleoli cytoskeleton (microtubules) U-2 OS uncertain strong nucleoli cytoskeleton (microtubules) supportive supportive IFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNG uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes strong hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes strong skin fibroblasts negative skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 2 fibroblasts weak spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak endometrial cancer tumor cells weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive supportive MAP2K6 MAPKK6 MEK6 MKK6 PRKMK6 SAPKK3 medium adrenal gland glandular cells none appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells low breast adipocytes low breast glandular cells high breast myoepithelial cells high bronchus respiratory epithelial cells low cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells medium cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion low duodenum glandular cells high epididymis glandular cells low esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes none hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli high kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes low lung macrophages low lung pneumocytes low lymph node germinal center cells low lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary follicle cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells none placenta decidual cells low placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells high salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 chondrocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells low stomach, upper glandular cells medium testis cells in seminiferus ducts none testis Leydig cells none thyroid gland glandular cells low tonsil germinal center cells low tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells low uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells high vagina squamous epithelial cells low vulva/anal skin epidermal cells low supportive nucleus but not nucleoli A-549 High Hep-G2 Medium HeLa Medium PC-3 Medium RT-4 Medium U-251 MG Low CACO-2 Low U-2 OS Low HEK 293 Low MCF-7 Not detected A-431 Not detected uncertain adrenal gland glandular cells negative appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells weak cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells strong duodenum glandular cells strong epididymis glandular cells weak esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli strong kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells weak lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans weak skin melanocytes weak small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells weak stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells strong moderate negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells strong moderate weak negative supportive U-251 MG supportive weak nucleus but not nucleoli A-431 supportive weak nucleus but not nucleoli U-2 OS supportive weak nucleus but not nucleoli supportive SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages weak lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells weak rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts negative skin keratinocytes negative skin Langerhans weak skin melanocytes weak small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells moderate negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells weak negative skin cancer tumor cells strong weak negative stomach cancer tumor cells negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells strong moderate negative supportive supportive MAP2K7 Jnkk2 MKK7 PRKMK7 high adrenal gland glandular cells low appendix glandular cells low appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells low breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells low gallbladder glandular cells low heart muscle myocytes medium hippocampus glial cells medium hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules low lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells low liver hepatocytes low lung macrophages high lung pneumocytes none lymph node germinal center cells medium lymph node non-germinal center cells low nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells none ovary follicle cells low ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells low placenta trophoblastic cells high prostate glandular cells low rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes none skin fibroblasts medium skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve low soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma medium uterus, pre-menopause glandular cells low vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium n/a PC-3 High HEK 293 High U-251 MG Medium A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium RT-4 Medium A-431 Medium U-2 OS Medium LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETMEV supportive adrenal gland glandular cells weak appendix glandular cells weak appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells weak heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells weak kidney cells in glomeruli weak kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes weak lung macrophages strong lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes negative skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive supportive adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells weak cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells strong placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes weak soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells negative testis cells in seminiferus ducts strong testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells weak stomach cancer tumor cells strong moderate weak negative testis cancer tumor cells strong moderate negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak uncertain U-251 MG uncertain weak A-431 uncertain weak U-2 OS uncertain negative supportive MAP3K13 LZK MEKK13 low adrenal gland glandular cells low appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes none breast glandular cells low breast myoepithelial cells medium bronchus respiratory epithelial cells low cerebellum cells in granular layer low cerebellum cells in molecular layer none cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil low cervix, uterine glandular cells low cervix, uterine squamous epithelial cells none colon endothelial cells none colon glandular cells medium colon peripheral nerve/ganglion medium duodenum glandular cells medium epididymis glandular cells low esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes none lung macrophages none lung pneumocytes low lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary follicle cells low ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells none placenta trophoblastic cells low prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells none seminal vesicle glandular cells low skeletal muscle myocytes medium skin fibroblasts medium skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells medium soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells high testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells none tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells medium vagina squamous epithelial cells none vulva/anal skin epidermal cells medium non-supportive nucleoli PC-3 High A-431 High HEK 293 High U-251 MG Medium A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium RT-4 Medium U-2 OS Medium KKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQP uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate oral mucosa squamous epithelial cells strong ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak carcinoid tumor cells strong weak negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate negative lung cancer tumor cells moderate weak negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate weak negative supportive supportive LADKLEDRLAEKLDDLLSQTPEIPIDISSHSDGLSDKECAVRRVKTQMSLGKLCVEERGYENPMQFEESDCDSSDGECSDATVRTNKHYSSATW uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes negative lung macrophages negative lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells weak placenta decidual cells negative placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes weak skin Langerhans moderate skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate negative pancreatic cancer tumor cells strong moderate negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells strong moderate weak negative skin cancer tumor cells moderate negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells moderate weak non-supportive U-251 MG non-supportive weak nucleoli A-431 non-supportive weak nucleoli U-2 OS non-supportive weak nucleoli non-supportive uncertain MHGQDIATCANNLRYFGPAAALRSPLSNHAQRQLPGSSPDLISTAMAADCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSL uncertain adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain supportive MAP3K8 c-COT COT EST ESTF MEKK8 Tpl-2 high adrenal gland glandular cells high appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes medium breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells high cerebellum cells in granular layer medium cerebellum cells in molecular layer high cerebellum Purkinje cells high cerebral cortex endothelial cells medium cerebral cortex glial cells medium cerebral cortex neuronal cells high cerebral cortex neuropil medium cervix, uterine glandular cells high cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells medium hippocampus neuronal cells high kidney cells in glomeruli medium kidney cells in tubules high lateral ventricle glial cells medium lateral ventricle neuronal cells medium liver bile duct cells medium liver hepatocytes medium lung macrophages high lung pneumocytes medium lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells medium ovary follicle cells medium ovary ovarian stroma cells low pancreas exocrine glandular cells high pancreas islets of Langerhans medium parathyroid gland glandular cells high placenta decidual cells high placenta trophoblastic cells high prostate glandular cells high rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells high skeletal muscle myocytes medium skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells medium soft tissue 1 adipocytes medium soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve medium soft tissue 2 adipocytes medium soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve medium spleen cells in red pulp medium spleen cells in white pulp high stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts high testis Leydig cells high thyroid gland glandular cells high tonsil germinal center cells medium tonsil non-germinal center cells high tonsil squamous epithelial cells medium urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma medium uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma medium uterus, pre-menopause glandular cells high vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium supportive cytoplasm A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium RT-4 Medium A-431 Medium U-251 MG Low PC-3 Low U-2 OS Low HEK 293 Low supportive adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes moderate breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells strong placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate carcinoid tumor cells moderate cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate lymphoma tumor cells strong moderate melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate renal cancer tumor cells strong moderate skin cancer tumor cells moderate weak stomach cancer tumor cells strong moderate testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate supportive ENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDV supportive adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes moderate breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer strong cerebellum cells in molecular layer strong cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil strong cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells negative colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver hepatocytes strong lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary follicle cells moderate ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells strong placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts strong skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells strong moderate carcinoid tumor cells strong moderate weak cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate weak skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong urothelial cancer tumor cells strong moderate supportive U-251 MG supportive weak cytoplasm A-431 supportive moderate cytoplasm U-2 OS supportive moderate cytoplasm supportive supportive MAP4K1 HPK1 medium adrenal gland glandular cells none appendix glandular cells none appendix lymphoid tissue medium bone marrow hematopoietic cells high breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells none cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells none colon glandular cells none colon peripheral nerve/ganglion none duodenum glandular cells none epididymis glandular cells none esophagus squamous epithelial cells none fallopian tube glandular cells none gallbladder glandular cells none heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules none lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes none lung macrophages low lung pneumocytes none lymph node germinal center cells high lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans none parathyroid gland glandular cells none placenta decidual cells none placenta trophoblastic cells none prostate glandular cells none rectum glandular cells none salivary gland glandular cells none seminal vesicle glandular cells none skeletal muscle myocytes low skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells none smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 chondrocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp medium stomach, lower glandular cells none stomach, upper glandular cells none testis cells in seminiferus ducts none testis Leydig cells none thyroid gland glandular cells none tonsil germinal center cells high tonsil non-germinal center cells medium tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells none very low nucleus but not nucleoli plasma membrane A-549 Low CACO-2 Low Hep-G2 Low HeLa Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low U-2 OS Low HEK 293 Low U-251 MG Not detected LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells strong cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells strong lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp moderate stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells strong tonsil non-germinal center cells moderate tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells negative lung cancer tumor cells negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain weak nucleus but not nucleoli A-431 uncertain weak nucleus but not nucleoli cytoplasm U-2 OS uncertain weak nucleus but not nucleoli non-supportive supportive supportive adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue strong bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells negative heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes strong lung macrophages negative lung pneumocytes negative lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative placenta decidual cells weak placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp strong stomach, lower glandular cells negative stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells negative thyroid gland glandular cells weak tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells negative urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells strong negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells strong moderate negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells moderate negative testis cancer tumor cells moderate negative thyroid cancer tumor cells negative urothelial cancer tumor cells moderate negative uncertain U-251 MG uncertain weak A-431 uncertain weak plasma membrane U-2 OS uncertain negative uncertain OXSR1 KIAA1101 OSR1 high adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue medium bone marrow hematopoietic cells low breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells medium cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil low cervix, uterine glandular cells high cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion medium duodenum glandular cells medium epididymis glandular cells high esophagus squamous epithelial cells high fallopian tube glandular cells high gallbladder glandular cells medium heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells none kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells low liver bile duct cells medium liver hepatocytes medium lung macrophages medium lung pneumocytes high lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells medium pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes medium skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells medium soft tissue 1 adipocytes low soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve medium soft tissue 2 adipocytes medium soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve medium spleen cells in red pulp medium spleen cells in white pulp high stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts high testis Leydig cells medium thyroid gland glandular cells high tonsil germinal center cells high tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma medium uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium medium cytoplasm mitochondria plasma membrane U-251 MG High HeLa High RT-4 High A-431 High U-2 OS High A-549 Medium CACO-2 Medium Hep-G2 Medium MCF-7 Medium PC-3 Medium HEK 293 Medium FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFE uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells weak epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells negative liver bile duct cells moderate liver hepatocytes negative lung macrophages moderate lung pneumocytes strong lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells weak thyroid gland glandular cells strong tonsil germinal center cells strong tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells strong moderate negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak head and neck cancer tumor cells strong moderate negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate weak melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate weak stomach cancer tumor cells moderate weak negative testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells strong moderate weak uncertain U-251 MG uncertain moderate cytoplasm A-431 uncertain moderate cytoplasm U-2 OS uncertain moderate cytoplasm supportive supportive uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells strong breast adipocytes weak breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells strong colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli strong kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells negative liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary ovarian stroma cells strong pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells strong placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells strong tonsil non-germinal center cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells strong breast cancer tumor cells strong moderate carcinoid tumor cells strong moderate negative cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak head and neck cancer tumor cells strong moderate liver cancer tumor cells strong weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate weak uncertain U-251 MG uncertain strong plasma membrane cytoplasm mitochondria A-431 uncertain moderate plasma membrane cytoplasm U-2 OS uncertain strong cytoplasm mitochondria supportive PAK1 medium adrenal gland glandular cells low appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells high breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer high cerebellum Purkinje cells high cerebral cortex endothelial cells none cerebral cortex glial cells low cerebral cortex neuronal cells high cerebral cortex neuropil medium cervix, uterine glandular cells low cervix, uterine squamous epithelial cells low colon endothelial cells none colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells high heart muscle myocytes none hippocampus glial cells low hippocampus neuronal cells high kidney cells in glomeruli high kidney cells in tubules low lateral ventricle glial cells low lateral ventricle neuronal cells high liver bile duct cells low liver hepatocytes low lung macrophages medium lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta trophoblastic cells medium prostate glandular cells high rectum glandular cells high salivary gland glandular cells low seminal vesicle glandular cells medium skeletal muscle myocytes low skin fibroblasts none skin keratinocytes medium skin Langerhans high skin melanocytes none small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes low soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp high spleen cells in white pulp medium stomach, lower glandular cells low stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells low tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells high vagina squamous epithelial cells low vulva/anal skin epidermal cells low supportive plasma membrane cytoplasm golgi apparatus U-251 MG High A-549 High CACO-2 High RT-4 High A-431 High U-2 OS High HEK 293 High HeLa Medium PC-3 Medium Hep-G2 Low MCF-7 Low NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer strong cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells strong cerebral cortex neuropil strong cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells moderate liver hepatocytes negative lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells weak lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes moderate skin Langerhans strong skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak glioma tumor cells strong moderate weak head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells moderate weak prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak skin cancer tumor cells moderate weak stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak supportive U-251 MG supportive weak plasma membrane cytoplasm A-431 supportive moderate plasma membrane cytoplasm golgi apparatus U-2 OS supportive strong plasma membrane cytoplasm supportive supportive uncertain adrenal gland glandular cells weak appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer strong cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells weak fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells strong kidney cells in glomeruli strong kidney cells in tubules weak lateral ventricle glial cells weak lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans strong skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp strong spleen cells in white pulp moderate stomach, lower glandular cells weak stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells negative breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate weak melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak non-supportive STK10 LOK PRO2729 low adrenal gland glandular cells none appendix glandular cells none appendix lymphoid tissue high bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer medium cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells medium cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells none colon glandular cells none colon peripheral nerve/ganglion none duodenum glandular cells none epididymis glandular cells low esophagus squamous epithelial cells none fallopian tube glandular cells none gallbladder glandular cells low heart muscle myocytes none hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules none lateral ventricle glial cells medium lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes none lung macrophages medium lung pneumocytes none lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells medium placenta trophoblastic cells low prostate glandular cells none rectum glandular cells low salivary gland glandular cells none seminal vesicle glandular cells low skeletal muscle myocytes none skin fibroblasts low skin keratinocytes none skin Langerhans none skin melanocytes low small intestine glandular cells low smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp high spleen cells in white pulp high stomach, lower glandular cells none stomach, upper glandular cells low testis cells in seminiferus ducts medium testis Leydig cells none thyroid gland glandular cells none tonsil germinal center cells medium tonsil non-germinal center cells high tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells none uncertain nucleus but not nucleoli MCF-7 High RT-4 High U-251 MG Medium A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium PC-3 Medium A-431 Medium U-2 OS Medium HEK 293 Medium TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells moderate cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules negative lateral ventricle glial cells moderate lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes negative lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells moderate placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes negative skin Langerhans negative skin melanocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp strong spleen cells in white pulp strong stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts moderate testis Leydig cells negative thyroid gland glandular cells negative tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells negative glioma tumor cells weak negative head and neck cancer tumor cells negative liver cancer tumor cells weak negative lung cancer tumor cells negative lymphoma tumor cells strong moderate negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain weak nucleus but not nucleoli A-431 uncertain moderate nucleus but not nucleoli U-2 OS uncertain moderate nucleus but not nucleoli supportive uncertain uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer strong cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil negative cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells strong lateral ventricle neuronal cells strong liver bile duct cells negative liver hepatocytes negative lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak testis cancer tumor cells moderate thyroid cancer tumor cells weak negative urothelial cancer tumor cells strong moderate weak non-supportive STK24 MST-3 MST3 MST3B STE20 STK3 high adrenal gland glandular cells medium appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells medium cerebral cortex endothelial cells medium cerebral cortex glial cells medium cerebral cortex neuronal cells low cerebral cortex neuropil medium cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells high fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells medium liver hepatocytes low lung macrophages medium lung pneumocytes medium lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells high placenta trophoblastic cells medium prostate glandular cells high rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes low skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes low soft tissue 1 fibroblasts medium soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp medium spleen cells in white pulp medium stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells high tonsil squamous epithelial cells high urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma medium uterus, pre-menopause glandular cells high vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium low nucleoli cytoplasm U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG supportive adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells moderate liver hepatocytes weak lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells moderate prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells moderate cervical cancer tumor cells moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells moderate lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak melanoma tumor cells moderate weak ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak skin cancer tumor cells moderate stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate uncertain U-251 MG uncertain weak A-431 uncertain negative U-2 OS uncertain negative supportive supportive IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes weak hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes negative lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp strong spleen cells in white pulp strong stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak carcinoid tumor cells strong moderate cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells strong moderate liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate lymphoma tumor cells strong moderate weak melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate weak urothelial cancer tumor cells strong moderate uncertain U-251 MG uncertain weak nucleoli cytoplasm A-431 uncertain weak nucleoli cytoplasm U-2 OS uncertain weak nucleoli cytoplasm supportive supportive STK3 KRS1 MST2 very low adrenal gland glandular cells low appendix glandular cells low appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes low breast glandular cells high breast myoepithelial cells low bronchus respiratory epithelial cells medium cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells none cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells low colon glandular cells low colon peripheral nerve/ganglion low duodenum glandular cells low epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells low gallbladder glandular cells low heart muscle myocytes low hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli none kidney cells in tubules low lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes low lung macrophages low lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans low parathyroid gland glandular cells low placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells low salivary gland glandular cells none seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes medium skin Langerhans low skin melanocytes low small intestine glandular cells low smooth muscle smooth muscle cells none soft tissue 1 adipocytes low soft tissue 1 chondrocytes low soft tissue 1 fibroblasts low soft tissue 2 adipocytes low soft tissue 2 chondrocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp none spleen cells in white pulp low stomach, lower glandular cells low stomach, upper glandular cells low testis cells in seminiferus ducts low testis Leydig cells medium thyroid gland glandular cells low tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells medium urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells low vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium A-431 High U-251 MG Medium A-549 Medium CACO-2 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium PC-3 Medium RT-4 Medium U-2 OS Medium HEK 293 Medium ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells strong breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells negative colon glandular cells negative colon peripheral nerve/ganglion negative duodenum glandular cells negative epididymis glandular cells moderate esophagus squamous epithelial cells strong fallopian tube glandular cells negative gallbladder glandular cells negative heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes moderate skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells weak stomach, upper glandular cells weak testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells moderate urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells strong negative liver cancer tumor cells negative lung cancer tumor cells strong weak negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells strong weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells strong moderate negative supportive supportive uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes moderate breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells weak pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate endometrial cancer tumor cells moderate glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak supportive STK4 KRS2 MST1 YSK3 low adrenal gland glandular cells medium appendix glandular cells low appendix lymphoid tissue high bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells low breast myoepithelial cells none bronchus respiratory epithelial cells low cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells none cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells low cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells low colon peripheral nerve/ganglion none duodenum glandular cells low epididymis glandular cells low esophagus squamous epithelial cells low fallopian tube glandular cells low gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules low lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes low lung macrophages low lung pneumocytes low lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells low ovary ovarian stroma cells low pancreas exocrine glandular cells low pancreas islets of Langerhans low parathyroid gland glandular cells low placenta decidual cells low placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells low salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells low smooth muscle smooth muscle cells low soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp high stomach, lower glandular cells low stomach, upper glandular cells low testis cells in seminiferus ducts medium testis Leydig cells low thyroid gland glandular cells low tonsil germinal center cells high tonsil non-germinal center cells high tonsil squamous epithelial cells medium urinary bladder urothelial cells low uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells low supportive nucleus cytoplasm CACO-2 High U-2 OS High U-251 MG Medium A-549 Medium Hep-G2 Medium HeLa Medium MCF-7 Medium PC-3 Medium RT-4 Medium A-431 Medium HEK 293 Medium uncertain appendix glandular cells negative appendix lymphoid tissue strong bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells negative breast myoepithelial cells weak bronchus respiratory epithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells negative duodenum glandular cells negative epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells negative smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells negative stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells negative glioma tumor cells strong moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate negative lung cancer tumor cells weak negative lymphoma tumor cells strong moderate negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate weak negative supportive IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF uncertain adrenal gland glandular cells weak appendix glandular cells negative appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells weak fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules negative lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells weak stomach, upper glandular cells negative testis cells in seminiferus ducts strong testis Leydig cells weak thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells weak negative lung cancer tumor cells negative lymphoma tumor cells strong moderate melanoma tumor cells moderate weak negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells weak negative skin cancer tumor cells weak negative stomach cancer tumor cells weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells negative urothelial cancer tumor cells moderate weak negative supportive U-251 MG supportive weak nucleus cytoplasm A-431 supportive weak nucleus cytoplasm U-2 OS supportive moderate nucleus cytoplasm supportive supportive STRADB ALS2CR2 CALS-21 ILPIP ILPIPA PAPK high adrenal gland glandular cells none appendix glandular cells none appendix lymphoid tissue none bone marrow hematopoietic cells none breast adipocytes none breast glandular cells none breast myoepithelial cells none bronchus respiratory epithelial cells none cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells none cerebral cortex endothelial cells medium cerebral cortex glial cells none cerebral cortex neuronal cells none cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells medium colon glandular cells none colon peripheral nerve/ganglion low duodenum glandular cells low epididymis glandular cells none esophagus squamous epithelial cells none fallopian tube glandular cells none gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells none hippocampus neuronal cells none kidney cells in glomeruli none kidney cells in tubules high lateral ventricle glial cells none lateral ventricle neuronal cells none liver bile duct cells none liver hepatocytes medium lung macrophages none lung pneumocytes none lymph node germinal center cells none lymph node non-germinal center cells none nasopharynx respiratory epithelial cells none oral mucosa squamous epithelial cells none ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans high parathyroid gland glandular cells none placenta decidual cells none placenta trophoblastic cells none prostate glandular cells none rectum glandular cells none salivary gland glandular cells none seminal vesicle glandular cells none skeletal muscle myocytes low skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells none smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 chondrocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells none stomach, upper glandular cells none testis cells in seminiferus ducts none testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells none tonsil non-germinal center cells none tonsil squamous epithelial cells none urinary bladder urothelial cells none uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells none uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells low low aggresome Hep-G2 High U-251 MG Medium A-549 Medium CACO-2 Medium HeLa Medium PC-3 Medium RT-4 Medium A-431 Medium U-2 OS Medium HEK 293 Medium MCF-7 Low VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS uncertain adrenal gland glandular cells moderate appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells strong colon glandular cells negative duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans strong parathyroid gland glandular cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells negative salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes negative skin Langerhans negative skin melanocytes moderate small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells negative stomach cancer tumor cells negative testis cancer tumor cells negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain strong aggresome supportive supportive FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE uncertain adrenal gland glandular cells negative appendix glandular cells negative appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells negative cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells negative colon peripheral nerve/ganglion moderate duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells negative testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells strong tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells negative colorectal cancer tumor cells negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells negative melanoma tumor cells moderate negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate negative testis cancer tumor cells weak negative thyroid cancer tumor cells strong urothelial cancer tumor cells moderate negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive uncertain TNIK KIAA0551 low adrenal gland glandular cells medium appendix glandular cells high appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells none breast myoepithelial cells low bronchus respiratory epithelial cells low cerebellum cells in granular layer low cerebellum cells in molecular layer medium cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells medium cerebral cortex neuronal cells medium cerebral cortex neuropil none cervix, uterine glandular cells none cervix, uterine squamous epithelial cells none colon endothelial cells low colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells none fallopian tube glandular cells medium gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells low lymph node non-germinal center cells low nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells low ovary ovarian stroma cells none pancreas exocrine glandular cells none pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta trophoblastic cells low prostate glandular cells low rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes medium skin fibroblasts none skin keratinocytes none skin Langerhans none skin melanocytes none small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes none soft tissue 1 chondrocytes medium soft tissue 1 fibroblasts none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells low thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells none vagina squamous epithelial cells none vulva/anal skin epidermal cells none supportive nucleus but not nucleoli cytoplasm CACO-2 High U-251 MG Medium PC-3 Medium U-2 OS Medium HEK 293 Medium A-549 Low Hep-G2 Low HeLa Low MCF-7 Low RT-4 Low A-431 Low QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells negative breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells weak negative supportive U-251 MG supportive weak nucleus but not nucleoli cytoplasm A-431 supportive weak nucleus but not nucleoli cytoplasm U-2 OS supportive weak nucleus but not nucleoli cytoplasm non-supportive supportive AKELRELRIEETNRPMKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLV supportive adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells weak colon glandular cells strong duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes weak skin Langerhans moderate skin melanocytes weak small intestine glandular cells strong smooth muscle smooth muscle cells strong soft tissue 1 adipocytes negative soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve weak spleen cells in red pulp strong spleen cells in white pulp strong stomach, lower glandular cells strong stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells strong moderate carcinoid tumor cells strong moderate cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate negative head and neck cancer tumor cells moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate skin cancer tumor cells moderate weak stomach cancer tumor cells strong weak testis cancer tumor cells strong moderate weak thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate non-supportive supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about