HTR2B 5-HT(2B) 5-HT2B high adrenal gland glandular cells medium appendix glandular cells high appendix lymphoid tissue none bone marrow hematopoietic cells low breast adipocytes none breast glandular cells high breast myoepithelial cells high bronchus respiratory epithelial cells high cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells high cervix, uterine squamous epithelial cells low colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion none duodenum glandular cells high epididymis glandular cells high esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli none kidney cells in tubules high lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells high liver hepatocytes medium lung macrophages low lung pneumocytes high lymph node germinal center cells none lymph node non-germinal center cells low nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells low ovary ovarian stroma cells none pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells none placenta trophoblastic cells high prostate glandular cells high rectum glandular cells high salivary gland glandular cells high seminal vesicle glandular cells high skeletal muscle myocytes low skin fibroblasts none skin keratinocytes low skin Langerhans none skin melanocytes none small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve medium spleen cells in red pulp none spleen cells in white pulp none stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells high urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma none uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells high vagina squamous epithelial cells medium vulva/anal skin epidermal cells low uncertain A-549 Low MCF-7 Low PC-3 Low RT-4 Low U-2 OS Low U-251 MG Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected A-431 Not detected HEK 293 Not detected supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer strong cerebellum Purkinje cells moderate cerebral cortex endothelial cells moderate cerebral cortex glial cells strong cerebral cortex neuronal cells strong cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells strong hippocampus neuronal cells strong kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells moderate lateral ventricle neuronal cells moderate liver bile duct cells strong liver hepatocytes strong lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes strong skin fibroblasts weak skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate carcinoid tumor cells moderate cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate endometrial cancer tumor cells moderate weak glioma tumor cells weak negative head and neck cancer tumor cells moderate liver cancer tumor cells moderate lung cancer tumor cells moderate lymphoma tumor cells weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate pancreatic cancer tumor cells moderate prostate cancer tumor cells moderate negative renal cancer tumor cells moderate weak skin cancer tumor cells moderate stomach cancer tumor cells moderate testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate urothelial cancer tumor cells moderate non-supportive TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue negative bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells strong cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells strong liver hepatocytes moderate lung macrophages weak lung pneumocytes strong lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells negative placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells negative breast cancer tumor cells strong carcinoid tumor cells strong moderate negative cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate weak endometrial cancer tumor cells strong moderate negative glioma tumor cells weak negative head and neck cancer tumor cells strong weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells strong moderate negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate weak renal cancer tumor cells strong moderate weak negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong testis cancer tumor cells strong moderate negative thyroid cancer tumor cells strong negative urothelial cancer tumor cells strong weak uncertain U-251 MG uncertain weak A-431 uncertain weak U-2 OS uncertain negative uncertain supportive HTR2C 5-HT2C HTR1C low adrenal gland glandular cells medium appendix glandular cells low appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes medium breast glandular cells low breast myoepithelial cells low bronchus respiratory epithelial cells low cerebellum cells in granular layer low cerebellum cells in molecular layer low cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil low cervix, uterine glandular cells low cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells low colon peripheral nerve/ganglion low duodenum glandular cells low epididymis glandular cells low esophagus squamous epithelial cells low fallopian tube glandular cells low gallbladder glandular cells low heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules medium lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes low lung macrophages low lung pneumocytes low lymph node germinal center cells low lymph node non-germinal center cells low nasopharynx respiratory epithelial cells low oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells low pancreas exocrine glandular cells low pancreas islets of Langerhans high parathyroid gland glandular cells low placenta decidual cells low placenta trophoblastic cells medium prostate glandular cells low rectum glandular cells low salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells low smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes low soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes medium soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells low thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells low urinary bladder urothelial cells low uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells low uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells low vagina squamous epithelial cells low vulva/anal skin epidermal cells medium uncertain HeLa Low MCF-7 Low RT-4 Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected PC-3 Not detected A-431 Not detected HEK 293 Not detected TIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNER uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes moderate breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells weak colon glandular cells weak duodenum glandular cells weak epididymis glandular cells weak esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells weak heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells weak pancreas islets of Langerhans strong parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells weak rectum glandular cells weak salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells weak soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve weak soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells weak carcinoid tumor cells weak cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate urothelial cancer tumor cells moderate weak negative supportive supportive uncertain appendix glandular cells weak appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells negative colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells moderate kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells moderate liver bile duct cells weak liver hepatocytes strong lung macrophages strong lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells strong salivary gland glandular cells weak skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 chondrocytes strong soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells strong tonsil germinal center cells weak tonsil non-germinal center cells strong tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells strong moderate weak glioma tumor cells strong moderate head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells strong moderate weak skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain negative A-431 uncertain weak U-2 OS uncertain negative non-supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about