PSMA5 ZETA medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells medium breast adipocytes low breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells high cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes medium hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules low lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells low liver hepatocytes low lung macrophages medium lung pneumocytes low lymph node germinal center cells medium lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells none ovary ovarian stroma cells low pancreas exocrine glandular cells low pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes low skin fibroblasts medium skin keratinocytes medium skin Langerhans low skin melanocytes medium small intestine glandular cells low smooth muscle smooth muscle cells medium soft tissue 1 adipocytes low soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp medium spleen cells in white pulp medium stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts high testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells low tonsil squamous epithelial cells medium urinary bladder urothelial cells low uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma medium uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium low nucleus but not nucleoli cytoplasm U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High SPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDK supportive adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells moderate cerebral cortex neuronal cells strong cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes weak lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells weak smooth muscle smooth muscle cells negative soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve strong soft tissue 2 adipocytes weak soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve weak spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells moderate urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells strong moderate weak cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate endometrial cancer tumor cells strong moderate glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate prostate cancer tumor cells moderate weak renal cancer tumor cells moderate skin cancer tumor cells moderate weak stomach cancer tumor cells moderate testis cancer tumor cells moderate thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate weak supportive U-251 MG supportive moderate nucleus but not nucleoli cytoplasm A-431 uncertain weak U-2 OS supportive moderate nucleus but not nucleoli supportive supportive ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells moderate cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells weak kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells moderate prostate glandular cells strong rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes weak skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells strong moderate cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak glioma tumor cells moderate weak head and neck cancer tumor cells moderate liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak skin cancer tumor cells strong moderate weak stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak supportive U-251 MG supportive moderate cytoplasm A-431 supportive strong cytoplasm U-2 OS supportive strong cytoplasm supportive supportive ARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCD supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells moderate colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells weak placenta decidual cells moderate placenta trophoblastic cells weak prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative supportive U-251 MG supportive strong nucleus but not nucleoli cytoplasm A-431 supportive moderate nucleus but not nucleoli cytoplasm U-2 OS supportive strong nucleus but not nucleoli cytoplasm supportive supportive PSMB1 HC5 PMSB1 high adrenal gland glandular cells high appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes medium breast glandular cells low breast myoepithelial cells medium bronchus respiratory epithelial cells high cerebellum cells in granular layer medium cerebellum cells in molecular layer medium cerebellum Purkinje cells medium cerebral cortex endothelial cells medium cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules high lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells medium liver hepatocytes medium lung macrophages medium lung pneumocytes medium lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells high oral mucosa squamous epithelial cells medium ovary follicle cells medium ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells medium rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes low skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes medium soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 chondrocytes medium soft tissue 2 fibroblasts medium soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp medium stomach, lower glandular cells medium stomach, upper glandular cells high testis cells in seminiferus ducts high testis Leydig cells high thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells high uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells high vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium low plasma membrane cell junctions U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD supportive adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil moderate cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages weak lung pneumocytes weak lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells moderate prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes strong soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes weak soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells strong moderate cervical cancer tumor cells moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate thyroid cancer tumor cells moderate urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive supportive SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS supportive adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes moderate breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells strong ovary ovarian stroma cells weak pancreas exocrine glandular cells strong pancreas islets of Langerhans strong parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts moderate spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells strong tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate carcinoid tumor cells moderate weak negative cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate melanoma tumor cells strong moderate weak ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate weak prostate cancer tumor cells moderate weak renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate uncertain U-251 MG uncertain negative A-431 uncertain weak plasma membrane cell junctions U-2 OS uncertain negative supportive supportive supportive adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells moderate colon glandular cells moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells moderate liver hepatocytes moderate lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate carcinoid tumor cells strong moderate cervical cancer tumor cells strong moderate colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate head and neck cancer tumor cells moderate negative liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells strong moderate ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate prostate cancer tumor cells strong moderate negative renal cancer tumor cells moderate weak skin cancer tumor cells strong moderate weak stomach cancer tumor cells moderate weak testis cancer tumor cells strong moderate thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate supportive PSMB2 HC7-I low adrenal gland glandular cells medium appendix glandular cells high appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells high cerebellum cells in granular layer medium cerebellum cells in molecular layer low cerebellum Purkinje cells high cerebral cortex endothelial cells none cerebral cortex glial cells low cerebral cortex neuronal cells medium cerebral cortex neuropil low cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells high colon peripheral nerve/ganglion medium duodenum glandular cells high epididymis glandular cells high esophagus squamous epithelial cells medium fallopian tube glandular cells high gallbladder glandular cells high heart muscle myocytes high hippocampus glial cells none hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules high lateral ventricle glial cells low lateral ventricle neuronal cells medium liver bile duct cells medium liver hepatocytes high lung macrophages low lung pneumocytes low lymph node germinal center cells high lymph node non-germinal center cells high nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells high pancreas islets of Langerhans medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells high prostate glandular cells high rectum glandular cells high salivary gland glandular cells medium seminal vesicle glandular cells high skeletal muscle myocytes high skin fibroblasts low skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp low spleen cells in white pulp medium stomach, lower glandular cells high stomach, upper glandular cells high testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells high tonsil squamous epithelial cells medium urinary bladder urothelial cells high uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells high vagina squamous epithelial cells low vulva/anal skin epidermal cells medium supportive nucleus but not nucleoli U-251 MG High A-549 High CACO-2 High Hep-G2 High HeLa High MCF-7 High PC-3 High RT-4 High A-431 High U-2 OS High HEK 293 High LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells strong cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells moderate liver hepatocytes strong lung macrophages weak lung pneumocytes weak lymph node germinal center cells strong lymph node non-germinal center cells strong nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells strong skeletal muscle myocytes strong skin fibroblasts weak skin keratinocytes moderate skin Langerhans weak skin melanocytes weak small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells moderate weak lung cancer tumor cells moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak renal cancer tumor cells strong moderate weak skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak testis cancer tumor cells moderate weak thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate weak supportive U-251 MG supportive weak nucleus but not nucleoli A-431 supportive moderate nucleus but not nucleoli U-2 OS uncertain negative supportive supportive YVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTP supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells strong breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells weak placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells negative seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp moderate stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells weak tonsil squamous epithelial cells strong urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate negative urothelial cancer tumor cells moderate weak uncertain supportive PSMB8 beta5i D6S216E LMP7 PSMB5i RING10 high adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue medium bone marrow hematopoietic cells medium breast adipocytes none breast glandular cells medium breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer none cerebellum cells in molecular layer none cerebellum Purkinje cells low cerebral cortex endothelial cells medium cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil none cervix, uterine glandular cells medium cervix, uterine squamous epithelial cells medium colon endothelial cells medium colon glandular cells medium colon peripheral nerve/ganglion medium duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes none hippocampus glial cells none hippocampus neuronal cells low kidney cells in glomeruli medium kidney cells in tubules medium lateral ventricle glial cells none lateral ventricle neuronal cells low liver bile duct cells medium liver hepatocytes medium lung macrophages medium lung pneumocytes medium lymph node germinal center cells medium lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary follicle cells none ovary ovarian stroma cells none pancreas exocrine glandular cells low pancreas islets of Langerhans low parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells none prostate glandular cells medium rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes none skin fibroblasts medium skin keratinocytes medium skin Langerhans medium skin melanocytes medium small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 chondrocytes none soft tissue 1 fibroblasts medium soft tissue 2 adipocytes none soft tissue 2 fibroblasts none soft tissue 2 peripheral nerve none spleen cells in red pulp medium spleen cells in white pulp medium stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma medium uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma medium uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells medium uncertain vesicles cytoskeleton (cytokinetic bridge) U-251 MG High Hep-G2 High HeLa High RT-4 High A-431 High U-2 OS High A-549 Medium PC-3 Medium CACO-2 Low MCF-7 Low HEK 293 Not detected GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ supportive adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells strong colon endothelial cells moderate colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli moderate kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells strong liver hepatocytes moderate lung macrophages moderate lung pneumocytes strong lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells strong ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans weak parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells negative prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp strong stomach, lower glandular cells strong stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells strong tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate negative carcinoid tumor cells strong moderate negative cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate weak liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak negative lymphoma tumor cells strong moderate melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate urothelial cancer tumor cells strong moderate weak negative supportive uncertain RPNLSPEEAYDLGRRAIAYATHRDS supportive adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells moderate colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells moderate liver hepatocytes moderate lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells weak placenta trophoblastic cells negative prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts negative skin keratinocytes weak skin Langerhans weak skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells moderate thyroid gland glandular cells weak tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells strong negative cervical cancer tumor cells moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells strong moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells moderate weak testis cancer tumor cells negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative uncertain HeLa uncertain moderate vesicles cytoskeleton (cytokinetic bridge) U-2 OS uncertain moderate vesicles cytoskeleton (cytokinetic bridge) U-251 MG uncertain weak uncertain uncertain Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about