NOX1 GP91-2 MOX1 NOH-1 NOH1

medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes low breast glandular cells high bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer none cerebellum Purkinje cells low cerebral cortex endothelial cells low cerebral cortex glial cells medium cerebral cortex neuronal cells medium cerebral cortex neuropil none cervix, uterine glandular cells low cervix, uterine squamous epithelial cells medium colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells medium fallopian tube glandular cells medium gallbladder glandular cells high heart muscle myocytes low hippocampus glial cells medium hippocampus neuronal cells low kidney cells in glomeruli low kidney cells in tubules medium lateral ventricle glial cells medium lateral ventricle neuronal cells low liver bile duct cells medium liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells none lymph node non-germinal center cells medium nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells medium ovary ovarian stroma cells none pancreas exocrine glandular cells medium parathyroid gland glandular cells medium placenta decidual cells medium placenta trophoblastic cells medium prostate glandular cells high rectum glandular cells medium salivary gland glandular cells medium seminal vesicle glandular cells medium skeletal muscle myocytes none skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes medium small intestine glandular cells high smooth muscle smooth muscle cells none soft tissue 1 adipocytes none soft tissue 1 chondrocytes none soft tissue 1 fibroblasts none soft tissue 1 peripheral nerve none soft tissue 2 adipocytes none soft tissue 2 chondrocytes none soft tissue 2 fibroblasts none spleen cells in red pulp low spleen cells in white pulp medium stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts low testis Leydig cells high thyroid gland glandular cells medium tonsil germinal center cells medium tonsil non-germinal center cells medium tonsil squamous epithelial cells medium urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma low uterus, pre-menopause glandular cells medium vagina squamous epithelial cells low vulva/anal skin epidermal cells medium

uncertain mitochondria

CACO-2 Medium U-251 MG Low RT-4 Low U-2 OS Low A-549 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected HEK 293 Not detected TEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHP

uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue strong bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion weak duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes negative hippocampus glial cells weak hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells moderate liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells strong parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts moderate soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells moderate thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma moderate uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate weak negative carcinoid tumor cells strong weak negative cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells strong moderate weak liver cancer tumor cells strong moderate weak lung cancer tumor cells strong moderate weak lymphoma tumor cells moderate weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells strong moderate prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells strong moderate weak negative supportive supportive LFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFT

uncertain adrenal gland glandular cells strong appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells strong breast myoepithelial cells strong bronchus respiratory epithelial cells strong cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells weak cerebral cortex endothelial cells moderate cerebral cortex glial cells strong cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells strong hippocampus neuronal cells weak kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells strong lateral ventricle neuronal cells weak liver bile duct cells moderate liver hepatocytes strong lung macrophages strong lung pneumocytes weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells moderate parathyroid gland glandular cells strong placenta decidual cells negative placenta trophoblastic cells moderate prostate glandular cells strong rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts moderate skin keratinocytes weak skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp weak spleen cells in white pulp strong stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate carcinoid tumor cells strong moderate negative cervical cancer tumor cells strong moderate negative colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak negative head and neck cancer tumor cells moderate weak liver cancer tumor cells strong moderate lung cancer tumor cells strong moderate weak lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate weak ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells strong moderate prostate cancer tumor cells strong renal cancer tumor cells strong moderate skin cancer tumor cells strong moderate weak stomach cancer tumor cells strong moderate weak testis cancer tumor cells strong moderate negative thyroid cancer tumor cells strong weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain weak mitochondria A-431 uncertain strong mitochondria U-2 OS uncertain weak mitochondria supportive supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about