KCNK1 DPK K2p1.1 TWIK-1

medium adrenal gland glandular cells medium appendix glandular cells medium appendix lymphoid tissue low bone marrow hematopoietic cells low breast adipocytes low breast glandular cells low breast myoepithelial cells medium bronchus respiratory epithelial cells medium cerebellum cells in granular layer medium cerebellum cells in molecular layer low cerebellum Purkinje cells medium cerebral cortex endothelial cells low cerebral cortex glial cells low cerebral cortex neuronal cells low cerebral cortex neuropil medium cervix, uterine squamous epithelial cells low colon endothelial cells low colon glandular cells medium colon peripheral nerve/ganglion low duodenum glandular cells medium epididymis glandular cells medium esophagus squamous epithelial cells low fallopian tube glandular cells medium gallbladder glandular cells medium heart muscle myocytes low hippocampus glial cells low hippocampus neuronal cells medium kidney cells in glomeruli low kidney cells in tubules high lateral ventricle glial cells low lateral ventricle neuronal cells low liver bile duct cells low liver hepatocytes medium lung macrophages medium lung pneumocytes low lymph node germinal center cells low lymph node non-germinal center cells low nasopharynx respiratory epithelial cells medium oral mucosa squamous epithelial cells low ovary follicle cells low ovary ovarian stroma cells low pancreas exocrine glandular cells medium pancreas islets of Langerhans medium parathyroid gland glandular cells low placenta decidual cells low placenta trophoblastic cells high prostate glandular cells low rectum glandular cells medium salivary gland glandular cells low seminal vesicle glandular cells low skeletal muscle myocytes medium skin fibroblasts low skin keratinocytes low skin Langerhans low skin melanocytes low small intestine glandular cells medium smooth muscle smooth muscle cells low soft tissue 1 adipocytes low soft tissue 1 chondrocytes none soft tissue 1 fibroblasts low soft tissue 1 peripheral nerve low soft tissue 2 adipocytes low soft tissue 2 fibroblasts low soft tissue 2 peripheral nerve low spleen cells in red pulp low spleen cells in white pulp low stomach, lower glandular cells medium stomach, upper glandular cells medium testis cells in seminiferus ducts medium testis Leydig cells medium thyroid gland glandular cells medium tonsil germinal center cells low tonsil non-germinal center cells medium tonsil squamous epithelial cells low urinary bladder urothelial cells medium uterus, post-menopause cells in endometrial stroma low uterus, post-menopause glandular cells medium uterus, pre-menopause cells in endometrial stroma none uterus, pre-menopause glandular cells medium vagina squamous epithelial cells medium vulva/anal skin epidermal cells low

low cytoplasm

HeLa High PC-3 High RT-4 High A-431 High A-549 Medium MCF-7 Medium U-2 OS Medium HEK 293 Medium U-251 MG Low CACO-2 Not detected Hep-G2 Not detected YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN

uncertain adrenal gland glandular cells moderate appendix glandular cells strong appendix lymphoid tissue weak bone marrow hematopoietic cells weak breast adipocytes weak breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion moderate duodenum glandular cells strong epididymis glandular cells moderate esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells strong heart muscle myocytes weak hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells negative liver bile duct cells weak liver hepatocytes moderate lung macrophages moderate lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells negative ovary follicle cells moderate ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells negative rectum glandular cells strong salivary gland glandular cells weak seminal vesicle glandular cells moderate skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes moderate soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp weak spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells strong thyroid gland glandular cells moderate tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells negative breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate negative melanoma tumor cells moderate weak ovarian cancer tumor cells strong moderate weak negative pancreatic cancer tumor cells moderate negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells strong moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain weak A-431 uncertain weak cytoplasm U-2 OS uncertain weak supportive supportive

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer weak cerebellum Purkinje cells moderate cerebral cortex endothelial cells weak cerebral cortex glial cells weak cerebral cortex neuronal cells weak cerebral cortex neuropil moderate cervix, uterine squamous epithelial cells weak colon endothelial cells weak colon glandular cells strong colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells negative hippocampus neuronal cells moderate kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes weak lung macrophages moderate lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells weak ovary follicle cells weak ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells weak placenta decidual cells weak placenta trophoblastic cells strong prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes weak skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve moderate soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak soft tissue 2 peripheral nerve negative spleen cells in red pulp moderate spleen cells in white pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells moderate tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma weak uterus, post-menopause glandular cells strong uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells strong moderate weak negative colorectal cancer tumor cells weak negative endometrial cancer tumor cells strong moderate weak glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells strong weak negative lymphoma tumor cells strong weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about