SCN10A hPN3 Nav1.8 PN3 SNS

uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells strong cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells weak colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes moderate lung macrophages negative lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak

U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected U-2 OS Not detected HEK 293 Not detected

uncertain adrenal gland glandular cells weak appendix glandular cells moderate appendix lymphoid tissue moderate bone marrow hematopoietic cells weak breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer negative cerebellum Purkinje cells strong cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells weak colon endothelial cells weak colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells weak liver hepatocytes moderate lung macrophages negative lung pneumocytes negative lymph node germinal center cells moderate lymph node non-germinal center cells weak nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells moderate pancreas exocrine glandular cells moderate pancreas islets of Langerhans moderate parathyroid gland glandular cells negative placenta trophoblastic cells weak prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells weak skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes negative small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative spleen cells in red pulp moderate stomach, lower glandular cells moderate stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells weak tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak breast cancer tumor cells weak negative carcinoid tumor cells moderate weak negative cervical cancer tumor cells weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak skin cancer tumor cells moderate negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells weak negative urothelial cancer tumor cells moderate weak negative non-supportive SCN11A NaN Nav1.9 SCN12A SNS-2

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells negative cerebral cortex neuropil strong cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 chondrocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil non-germinal center cells negative tonsil squamous epithelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak

uncertain

RT-4 Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected MCF-7 Not detected PC-3 Not detected A-431 Not detected HEK 293 Not detected EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer moderate cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells moderate cerebral cortex neuronal cells negative cerebral cortex neuropil strong cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells weak colon glandular cells weak colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells weak esophagus squamous epithelial cells moderate fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules weak lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages moderate lung pneumocytes moderate lymph node germinal center cells weak lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes moderate skin fibroblasts weak skin keratinocytes weak skin Langerhans moderate skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes weak soft tissue 1 chondrocytes moderate soft tissue 1 fibroblasts negative soft tissue 2 adipocytes weak soft tissue 2 chondrocytes weak soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve weak spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells negative stomach, upper glandular cells weak testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil non-germinal center cells negative tonsil squamous epithelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells weak vulva/anal skin epidermal cells weak breast cancer tumor cells weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells weak negative colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells weak negative lung cancer tumor cells negative lymphoma tumor cells weak negative melanoma tumor cells negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells moderate negative stomach cancer tumor cells weak negative testis cancer tumor cells weak negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain weak U-2 OS uncertain weak uncertain supportive SCN1A FEB3 GEFSP2 HBSCI NAC1 Nav1.1 SCN1 SMEI

uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer strong cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil strong cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells weak hippocampus neuronal cells strong kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong parathyroid gland glandular cells strong placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate

uncertain centrosome

Hep-G2 Low HeLa Low U-2 OS Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected MCF-7 Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected RRHLLKRTVKQASFTYNKNKIKGGANLLIKEDMIIDRINENSITEKTDLTMST

uncertain adrenal gland glandular cells strong appendix glandular cells strong appendix lymphoid tissue moderate bone marrow hematopoietic cells moderate breast adipocytes weak breast glandular cells moderate breast myoepithelial cells moderate bronchus respiratory epithelial cells strong cerebellum cells in granular layer strong cerebellum cells in molecular layer moderate cerebellum Purkinje cells strong cerebral cortex endothelial cells moderate cerebral cortex glial cells weak cerebral cortex neuronal cells strong cerebral cortex neuropil strong cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells strong colon glandular cells strong colon peripheral nerve/ganglion strong duodenum glandular cells strong esophagus squamous epithelial cells strong fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells weak hippocampus neuronal cells strong kidney cells in glomeruli moderate kidney cells in tubules strong lateral ventricle glial cells moderate lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages strong lung pneumocytes moderate lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells strong ovary ovarian stroma cells moderate pancreas exocrine glandular cells strong parathyroid gland glandular cells strong placenta decidual cells moderate placenta trophoblastic cells strong prostate glandular cells strong rectum glandular cells strong salivary gland glandular cells strong seminal vesicle glandular cells strong skeletal muscle myocytes strong skin fibroblasts moderate skin keratinocytes moderate skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes moderate soft tissue 1 fibroblasts moderate soft tissue 2 adipocytes moderate soft tissue 2 fibroblasts moderate soft tissue 2 peripheral nerve moderate spleen cells in red pulp weak spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts strong testis Leydig cells strong thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells moderate urinary bladder urothelial cells strong uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells strong vagina squamous epithelial cells moderate vulva/anal skin epidermal cells moderate breast cancer tumor cells strong moderate carcinoid tumor cells moderate cervical cancer tumor cells moderate weak colorectal cancer tumor cells strong moderate endometrial cancer tumor cells strong moderate glioma tumor cells strong moderate weak negative head and neck cancer tumor cells moderate liver cancer tumor cells strong moderate weak lung cancer tumor cells moderate lymphoma tumor cells strong moderate weak negative melanoma tumor cells moderate ovarian cancer tumor cells strong moderate pancreatic cancer tumor cells moderate weak prostate cancer tumor cells moderate renal cancer tumor cells moderate weak skin cancer tumor cells moderate weak stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate uncertain U-251 MG uncertain weak A-431 uncertain weak centrosome U-2 OS uncertain negative uncertain supportive SCN2A HBSCI HBSCII Nav1.2 SCN2A1 SCN2A2

uncertain adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

uncertain

HeLa Low PC-3 Low U-2 OS Low HEK 293 Low U-251 MG Not detected A-549 Not detected CACO-2 Not detected Hep-G2 Not detected MCF-7 Not detected RT-4 Not detected A-431 Not detected

uncertain adrenal gland glandular cells negative appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells weak colon peripheral nerve/ganglion negative duodenum glandular cells weak epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells negative gallbladder glandular cells weak heart muscle myocytes negative hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes negative lung macrophages negative lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells negative ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells negative pancreas islets of Langerhans negative parathyroid gland glandular cells negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells negative rectum glandular cells weak salivary gland glandular cells negative seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts negative skin keratinocytes negative skin Langerhans negative skin melanocytes negative small intestine glandular cells negative smooth muscle smooth muscle cells negative soft tissue 1 adipocytes negative soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells weak thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells negative vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells negative carcinoid tumor cells negative cervical cancer tumor cells weak negative colorectal cancer tumor cells negative endometrial cancer tumor cells negative glioma tumor cells negative head and neck cancer tumor cells negative liver cancer tumor cells moderate weak negative lung cancer tumor cells negative lymphoma tumor cells negative melanoma tumor cells negative ovarian cancer tumor cells negative pancreatic cancer tumor cells weak negative prostate cancer tumor cells negative renal cancer tumor cells negative skin cancer tumor cells negative stomach cancer tumor cells weak negative testis cancer tumor cells negative thyroid cancer tumor cells negative urothelial cancer tumor cells weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative non-supportive SCN3A Nav1.3

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta trophoblastic cells strong prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes strong skin fibroblasts weak skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells strong thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate

uncertain

A-549 Low HeLa Low PC-3 Low U-2 OS Low U-251 MG Not detected CACO-2 Not detected Hep-G2 Not detected MCF-7 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected SAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNG

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue weak bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer weak cerebellum cells in molecular layer weak cerebellum Purkinje cells weak cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil weak cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells moderate colon endothelial cells moderate colon glandular cells moderate colon peripheral nerve/ganglion moderate duodenum glandular cells moderate epididymis glandular cells moderate esophagus squamous epithelial cells moderate fallopian tube glandular cells strong gallbladder glandular cells strong heart muscle myocytes strong hippocampus glial cells negative hippocampus neuronal cells weak kidney cells in glomeruli weak kidney cells in tubules strong lateral ventricle glial cells negative lateral ventricle neuronal cells weak liver bile duct cells negative liver hepatocytes moderate lung macrophages weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells strong oral mucosa squamous epithelial cells negative ovary follicle cells weak ovary ovarian stroma cells weak pancreas exocrine glandular cells moderate pancreas islets of Langerhans weak parathyroid gland glandular cells negative placenta trophoblastic cells strong prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells moderate seminal vesicle glandular cells weak skeletal muscle myocytes strong skin fibroblasts weak skin keratinocytes moderate skin Langerhans weak skin melanocytes moderate small intestine glandular cells moderate smooth muscle smooth muscle cells weak soft tissue 1 adipocytes weak soft tissue 1 fibroblasts negative soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 chondrocytes moderate soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp weak stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts negative testis Leydig cells strong thyroid gland glandular cells weak tonsil germinal center cells weak tonsil non-germinal center cells weak tonsil squamous epithelial cells weak urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma weak uterus, pre-menopause glandular cells weak vagina squamous epithelial cells weak vulva/anal skin epidermal cells moderate breast cancer tumor cells moderate weak carcinoid tumor cells moderate weak negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak endometrial cancer tumor cells moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells weak liver cancer tumor cells moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells moderate weak negative thyroid cancer tumor cells moderate weak urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain negative U-2 OS uncertain negative uncertain supportive SCN4A HYKPP HYPP Nav1.4 SkM1

uncertain adrenal gland glandular cells strong appendix glandular cells moderate bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells strong thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

A-549 Low MCF-7 Low U-2 OS Low U-251 MG Not detected CACO-2 Not detected Hep-G2 Not detected HeLa Not detected PC-3 Not detected RT-4 Not detected A-431 Not detected HEK 293 Not detected MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE

uncertain adrenal gland glandular cells strong appendix glandular cells moderate bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells negative breast myoepithelial cells negative bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells weak cerebral cortex glial cells negative cerebral cortex neuronal cells negative cerebral cortex neuropil weak cervix, uterine glandular cells negative cervix, uterine squamous epithelial cells negative colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells negative esophagus squamous epithelial cells negative fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells weak hippocampus neuronal cells negative kidney cells in glomeruli negative kidney cells in tubules strong lateral ventricle glial cells weak lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes negative lung macrophages weak lung pneumocytes negative lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells weak oral mucosa squamous epithelial cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative parathyroid gland glandular cells moderate placenta decidual cells weak placenta trophoblastic cells moderate prostate glandular cells negative rectum glandular cells moderate salivary gland glandular cells weak seminal vesicle glandular cells negative skeletal muscle myocytes weak skin fibroblasts weak skin keratinocytes weak skin Langerhans negative skin melanocytes weak small intestine glandular cells moderate smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells negative testis cells in seminiferus ducts weak testis Leydig cells strong thyroid gland glandular cells negative tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells negative urinary bladder urothelial cells negative uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells weak uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells moderate weak negative lung cancer tumor cells moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells moderate weak negative ovarian cancer tumor cells moderate negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells weak negative skin cancer tumor cells negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells weak negative uncertain supportive SCN5A CDCD2 CMD1E CMPD2 HB1 HB2 HBBD HH1 ICCD IVF LQT3 Nav1.5 PFHB1 SSS1

A-549 Low CACO-2 Low MCF-7 Low PC-3 Low RT-4 Low U-2 OS Low HEK 293 Low U-251 MG Not detected Hep-G2 Not detected HeLa Not detected A-431 Not detected SCN8A CerIII MED NaCh6 Nav1.6 PN4

uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells strong colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells strong ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes strong skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells strong vulva/anal skin epidermal cells strong

uncertain cell junctions

U-251 MG Medium U-2 OS Medium A-549 Low CACO-2 Low Hep-G2 Low MCF-7 Low PC-3 Low RT-4 Low A-431 Low HEK 293 Low HeLa Not detected

uncertain adrenal gland glandular cells moderate appendix glandular cells weak appendix lymphoid tissue negative bone marrow hematopoietic cells negative breast adipocytes negative breast glandular cells weak breast myoepithelial cells weak bronchus respiratory epithelial cells weak cerebellum cells in granular layer negative cerebellum cells in molecular layer negative cerebellum Purkinje cells negative cerebral cortex endothelial cells negative cerebral cortex glial cells negative cerebral cortex neuronal cells weak cerebral cortex neuropil negative cervix, uterine glandular cells weak cervix, uterine squamous epithelial cells strong colon endothelial cells negative colon glandular cells moderate colon peripheral nerve/ganglion weak duodenum glandular cells moderate epididymis glandular cells negative esophagus squamous epithelial cells strong fallopian tube glandular cells weak gallbladder glandular cells moderate heart muscle myocytes weak hippocampus glial cells negative hippocampus neuronal cells negative kidney cells in tubules moderate lateral ventricle glial cells negative lateral ventricle neuronal cells negative liver bile duct cells negative liver hepatocytes weak lung pneumocytes weak lymph node germinal center cells negative lymph node non-germinal center cells negative nasopharynx respiratory epithelial cells negative oral mucosa squamous epithelial cells strong ovary follicle cells negative ovary ovarian stroma cells negative pancreas exocrine glandular cells weak pancreas islets of Langerhans negative placenta decidual cells negative placenta trophoblastic cells negative prostate glandular cells weak rectum glandular cells moderate salivary gland glandular cells weak skeletal muscle myocytes moderate skin fibroblasts negative skin keratinocytes strong skin Langerhans negative skin melanocytes negative small intestine glandular cells weak smooth muscle smooth muscle cells moderate soft tissue 1 adipocytes negative soft tissue 1 chondrocytes negative soft tissue 1 fibroblasts negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts negative soft tissue 2 peripheral nerve negative spleen cells in red pulp negative spleen cells in white pulp negative stomach, lower glandular cells moderate stomach, upper glandular cells moderate testis cells in seminiferus ducts weak testis Leydig cells weak thyroid gland glandular cells moderate tonsil germinal center cells negative tonsil non-germinal center cells negative tonsil squamous epithelial cells strong urinary bladder urothelial cells moderate uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells negative uterus, pre-menopause cells in endometrial stroma negative uterus, pre-menopause glandular cells weak vagina squamous epithelial cells strong vulva/anal skin epidermal cells strong breast cancer tumor cells moderate weak negative carcinoid tumor cells negative cervical cancer tumor cells moderate weak negative colorectal cancer tumor cells moderate weak negative endometrial cancer tumor cells moderate weak negative glioma tumor cells weak negative head and neck cancer tumor cells weak negative liver cancer tumor cells strong moderate weak negative lung cancer tumor cells weak negative lymphoma tumor cells negative melanoma tumor cells weak negative ovarian cancer tumor cells moderate weak negative pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells strong moderate weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells negative thyroid cancer tumor cells moderate weak negative urothelial cancer tumor cells moderate weak negative uncertain U-251 MG uncertain negative A-431 uncertain weak cell junctions U-2 OS uncertain negative non-supportive SCN9A ETHA Nav1.7 NE-NA NENA PN1

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes negative skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells strong urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak

RT-4 Medium U-251 MG Low A-549 Low CACO-2 Low Hep-G2 Low HeLa Low PC-3 Low U-2 OS Low HEK 293 Low MCF-7 Not detected A-431 Not detected

uncertain adrenal gland glandular cells moderate appendix glandular cells moderate appendix lymphoid tissue negative bone marrow hematopoietic cells moderate breast adipocytes negative breast glandular cells moderate breast myoepithelial cells weak bronchus respiratory epithelial cells moderate cerebellum cells in granular layer negative cerebellum cells in molecular layer moderate cerebellum Purkinje cells moderate cerebral cortex endothelial cells negative cerebral cortex glial cells weak cerebral cortex neuronal cells moderate cerebral cortex neuropil negative cervix, uterine glandular cells moderate cervix, uterine squamous epithelial cells weak colon endothelial cells negative colon glandular cells strong colon peripheral nerve/ganglion negative duodenum glandular cells strong epididymis glandular cells strong esophagus squamous epithelial cells moderate fallopian tube glandular cells moderate gallbladder glandular cells moderate heart muscle myocytes moderate hippocampus glial cells moderate hippocampus neuronal cells strong kidney cells in glomeruli weak kidney cells in tubules moderate lateral ventricle glial cells weak lateral ventricle neuronal cells strong liver bile duct cells weak liver hepatocytes moderate lung macrophages strong lung pneumocytes weak lymph node germinal center cells moderate lymph node non-germinal center cells moderate nasopharynx respiratory epithelial cells moderate oral mucosa squamous epithelial cells moderate ovary follicle cells moderate ovary ovarian stroma cells negative pancreas exocrine glandular cells strong pancreas islets of Langerhans moderate parathyroid gland glandular cells moderate placenta decidual cells strong placenta trophoblastic cells strong prostate glandular cells moderate rectum glandular cells strong salivary gland glandular cells moderate seminal vesicle glandular cells moderate skeletal muscle myocytes negative skin fibroblasts weak skin keratinocytes negative skin Langerhans moderate skin melanocytes moderate small intestine glandular cells strong smooth muscle smooth muscle cells negative soft tissue 1 adipocytes weak soft tissue 1 fibroblasts weak soft tissue 1 peripheral nerve negative soft tissue 2 adipocytes negative soft tissue 2 fibroblasts weak spleen cells in red pulp moderate spleen cells in white pulp weak stomach, lower glandular cells strong stomach, upper glandular cells strong testis cells in seminiferus ducts moderate testis Leydig cells moderate thyroid gland glandular cells strong tonsil germinal center cells moderate tonsil non-germinal center cells moderate tonsil squamous epithelial cells strong urinary bladder urothelial cells weak uterus, post-menopause cells in endometrial stroma negative uterus, post-menopause glandular cells moderate uterus, pre-menopause cells in endometrial stroma moderate uterus, pre-menopause glandular cells moderate vagina squamous epithelial cells negative vulva/anal skin epidermal cells weak breast cancer tumor cells moderate weak negative carcinoid tumor cells moderate negative cervical cancer tumor cells strong moderate weak colorectal cancer tumor cells strong moderate weak negative endometrial cancer tumor cells strong moderate weak negative glioma tumor cells moderate weak negative head and neck cancer tumor cells moderate negative liver cancer tumor cells moderate weak negative lung cancer tumor cells strong moderate weak negative lymphoma tumor cells moderate weak negative melanoma tumor cells strong moderate weak negative ovarian cancer tumor cells strong moderate weak pancreatic cancer tumor cells moderate weak negative prostate cancer tumor cells strong moderate weak negative renal cancer tumor cells moderate weak negative skin cancer tumor cells weak negative stomach cancer tumor cells moderate weak negative testis cancer tumor cells strong moderate weak negative thyroid cancer tumor cells strong moderate urothelial cancer tumor cells moderate weak negative non-supportive Copyrighted by the Human Protein Atlas, http://www.proteinatlas.org/about