ANKIB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019358

 

Antibody HPA021780

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019358 HPA021780 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

121 126 

Antigen sequence

ASRSENQDSLQALSSLDEDDPNILLAIQLSLQESGLALDEETRDFLSNEA
SLGAIGTSLPSRLDSVPRNTDSPRAALSSSELLELGDSLMRLGAENDPFS
TDTLSSHPLSEARSDFCPSSS
 
QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEG
VKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGN
EAANRGDGSDVSSQTPQTSSDWLEQV
 

Matching transcripts

ANKIB1-001 - ENSP00000265742 [100%]
 ANKIB1-001 - ENSP00000265742 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells of the seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:300 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:118 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

122.0 122.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ANKIB1-001