CASP10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017059

 

Antibody CAB003780

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA017059 1035-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

4 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

149  

Antigen sequence

KSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKK
LEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEE
VERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSL
 
 

Matching transcripts

CASP10-001 - ENSP00000286186 [100%]
CASP10-002 - ENSP00000272879 [100%]
CASP10-003 - ENSP00000237865 [100%]
CASP10-007 - ENSP00000363781 [100%]
CASP10-009 - ENSP00000314599 [100%]
CASP10-010 - ENSP00000396835 [100%]
CASP10-201 - ENSP00000353250 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.0, 54.6, 54.5, 51.8, 31.4, 28.4 59.0, 54.6, 54.5, 51.8, 31.4, 28.4, 13.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:20000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CASP10-001
 
CASP10-002
 
CASP10-003
 
CASP10-007
 
CASP10-009
 
CASP10-010
 
CASP10-201