SLC4A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015584

 

Antibody HPA063911

 

Antibody CAB034438

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA015584 HPA063911 sc-133190 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

104 98  

Antigen sequence

LLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGG
TEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVE
LPVP
 
DDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTH
KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLT
 
 

Matching transcripts

SLC4A1-001 - ENSP00000262418 [100%]
SLC4A1-201 - ENSP00000382190 [98%]
 SLC4A1-001 - ENSP00000262418 [100%]
SLC4A1-201 - ENSP00000382190 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows distinct positivity in erythrocytes.
More information
 Immunohistochemical staining of human spleen shows strong positivity in erythrocytes.
More information
 Immunohistochemical staining of human lung shows distinct positivity in erythrocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:2000 1:60000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data 

         Western Blot

Image

   

Description

  Application not done for this antibody. 

Target mass (kDa)

101.8, 60.8 101.8, 60.8  

Antibody dilution

1:250 1:270  

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3250  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SLC4A1-001
 
SLC4A1-201