CACNA2D2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034771

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034771 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

80 

Antigen sequence

EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGF
LVLSNQNHQWDQVGRFFSEVDANLMLALYN
 

Matching transcripts

CACNA2D2-001 - ENSP00000390329 [100%]
CACNA2D2-002 - ENSP00000266039 [100%]
CACNA2D2-003 - ENSP00000354228 [100%]
CACNA2D2-005 - ENSP00000418081 [100%]
CACNA2D2-201 - ENSP00000378519 [100%]
CACNA2D2-202 - ENSP00000390526 [100%]
CACNA2D2-007 - ENSP00000407393 [99%]
CACNA2D2-008 - ENSP00000404631 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

130.1, 129.8, 129.4, 129.3, 129.2, 129.1, 122.1 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CACNA2D2-001
 
CACNA2D2-002
 
CACNA2D2-003
 
CACNA2D2-005
 
CACNA2D2-007
 
CACNA2D2-008
 
CACNA2D2-201
 
CACNA2D2-202