ADAM22

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045282

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045282 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

73 

Antigen sequence

LMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQ
LTHVDQASFQVDAFGTSFILDVV
 

Matching transcripts

ADAM22-001 - ENSP00000265727 [100%]
ADAM22-002 - ENSP00000381267 [100%]
ADAM22-003 - ENSP00000381262 [100%]
ADAM22-004 - ENSP00000381260 [100%]
ADAM22-007 - ENSP00000391334 [100%]
ADAM22-201 - ENSP00000315900 [100%]
ADAM22-008 - ENSP00000381261 [99%]
ADAM22-009 - ENSP00000413899 [81%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells and strong nuclear staining in glial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:122 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

100.4, 100.3, 100.2, 96.6, 95.3, 89.5, 39.6, 21.9 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ADAM22-001
 
ADAM22-002
 
ADAM22-003
 
ADAM22-004
 
ADAM22-007
 
ADAM22-008
 
ADAM22-009
 
ADAM22-201