SPAG9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040446

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040446 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

125 

Antigen sequence

SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGA
SPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVY
TEHVFTDPLGVQIPEDLSPVYQSSN
 

Matching transcripts

SPAG9-001 - ENSP00000262013 [100%]
SPAG9-002 - ENSP00000349636 [100%]
SPAG9-003 - ENSP00000426900 [100%]
SPAG9-007 - ENSP00000423165 [100%]
SPAG9-019 - ENSP00000423346 [90%]
SPAG9-017 - ENSP00000430205 [88%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:475 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:147 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

146.2, 145.1, 144.7, 128.6, 26.3, 15.8 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SPAG9-001
 
SPAG9-002
 
SPAG9-003
 
SPAG9-007
 
SPAG9-017
 
SPAG9-019