BRCA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034966

 

Antibody CAB001946

 

Antibody CAB018369

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 Santa Cruz Biotechnology
 

Product name

HPA034966 05-842 sc-646 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Affinity 

Released in version

8 4 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Synthetic peptide 

Length (aa)

80   

Antigen sequence

RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQE
RPLTNKLKRKRRPTSGLHPEDFIKKADLAV
 
 
 

Matching transcripts

BRCA1-001 - ENSP00000350283 [100%]
BRCA1-004 - ENSP00000419988 [100%]
BRCA1-005 - ENSP00000418960 [100%]
BRCA1-006 - ENSP00000418775 [100%]
BRCA1-011 - ENSP00000419274 [100%]
BRCA1-026 - ENSP00000397145 [100%]
BRCA1-201 - ENSP00000310938 [100%]
BRCA1-202 - ENSP00000246907 [100%]
BRCA1-205 - ENSP00000326002 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:750 1:125 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

210.3, 207.7, 202.3, 181.4, 178.3, 174.4, 73.1, 70.0, 49.0 210.3, 207.7, 202.3, 181.4, 178.3, 174.4, 85.0, 80.6, 78.2, 76.2, 73.1, 70.0, 69.5, 63.6, 55.5, 53.4, 49.0, 39.8, 35.9, 29.5, 26.3, 25.1, 20.0, 19.8, 11.2, 10.9, 7.2, 6.7 210.3, 207.7, 202.3, 181.4, 178.3, 174.4, 85.0, 80.6, 78.2, 76.2, 73.1, 70.0, 69.5, 63.6, 55.5, 53.4, 49.0, 39.8, 35.9, 29.5, 26.3, 25.1, 20.0, 19.8, 11.2, 10.9, 7.2, 6.7 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
   

Antibody dilution

1:200   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
BRCA1-001
 
BRCA1-004
 
BRCA1-005
 
BRCA1-006
 
BRCA1-011
 
BRCA1-026
 
BRCA1-201
 
BRCA1-202
 
BRCA1-205