CD22

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024353

 

Antibody CAB002418

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA024353 NCL-CD22-2 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

127  

Antigen sequence

DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKN
CTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEI
QESQEVTLTCLLNFSCYGYPIQLQWLL
 
 

Matching transcripts

CD22-001 - ENSP00000442279 [100%]
CD22-002 - ENSP00000085219 [100%]
CD22-003 - ENSP00000441237 [100%]
CD22-004 - ENSP00000469984 [100%]
CD22-007 - ENSP00000471972 [100%]
CD22-202 - ENSP00000339349 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows distinct cytoplasmic positivity in a subset of lymphoid cells.
More information
 Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in white pulp.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:1200 1:30 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:200 1:40 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

95.3, 85.7, 84.5, 75.8, 26.0 95.3, 85.7, 84.5, 75.8, 75.4, 74.1, 26.0, 21.8, 18.9, 18.4, 17.1, 16.9, 16.1, 15.5, 12.3, 3.9 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD22-001
 
CD22-002
 
CD22-003
 
CD22-004
 
CD22-007
 
CD22-202