COX15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037727

 

Antibody HPA037728

 

Antibody HPA066096

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037727 HPA037728 HPA066096 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

54 55 30 

Antigen sequence

LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTE
FKFI
 
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVA
LQSGR
 
MGESWIPEDLFTFSPILRNVFENPTMVQFD
 

Matching transcripts

COX15-001 - ENSP00000016171 [100%]
COX15-002 - ENSP00000359514 [100%]
 COX15-001 - ENSP00000016171 [100%]
COX15-002 - ENSP00000359514 [100%]
 COX15-001 - ENSP00000016171 [100%]
COX15-002 - ENSP00000359514 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:100 1:20  

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data  

RNA consistency

Not done Not done  

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line A549 shows positivity in mitochondria.
More information
 

Antibody dilution

  1:58 

Validation IF

  Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

46.0, 43.8 46.0, 43.8 46.0, 43.8 

Antibody dilution

1:250 1:250 1:190 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:2350 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
COX15-001
 
COX15-002