DERA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055897

 

Antibody HPA059619

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055897 HPA059619 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

110 90 

Antigen sequence

ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDT
SSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALK
AAGCNIPVAS
 
GKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSL
VKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYAA
 

Matching transcripts

DERA-001 - ENSP00000416583 [100%]
DERA-006 - ENSP00000433051 [100%]
DERA-007 - ENSP00000436999 [100%]
 DERA-001 - ENSP00000416583 [100%]
DERA-003 - ENSP00000431757 [100%]
DERA-007 - ENSP00000436999 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:26  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.2, 30.5, 26.0 35.2, 30.5, 25.1 

Antibody dilution

1:130 1:170 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:2100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in a fraction of neuronal cells and neurofibrils were distinctly stained.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:400 

Literature conformity

 No avaliable characterization data 

RNA consistency

 Not done 
 

ANTIGEN VIEW

? »
 
 
 
DERA-001
 
DERA-003
 
DERA-006
 
DERA-007