PHF20

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029619

 

Antibody HPA029620

 

Antibody HPA029621

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029619 HPA029620 HPA029621 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

102 94 87 

Antigen sequence

VRVKPKKKKKKKKKTKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPG
VHMSPQLHGPESGHHKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTT
NP
 
WCQPWKQHSGEGRSHFRNIPVTDTRSKEEAPSYRTLNGAVEKPRPLALPL
PRSVEESYITSEHCYQKPRAYYPAVEQKLVVETRGSALDDAVNP
 
PSIAPTAVDSNSQTLQPITLELRRRKISKGCEVPLKRPRLDKNSSQEKSK
NYSENTDKDLSRRRSSRLSTNGTHEILDPDLVVSDLV
 

Matching transcripts

PHF20-003 - ENSP00000363124 [100%]
 PHF20-003 - ENSP00000363124 [100%]
 PHF20-001 - ENSP00000341900 [100%]
PHF20-003 - ENSP00000363124 [100%]
PHF20-004 - ENSP00000363112 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human esophagus shows strong nuclear membranous positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:225  1:225 

Literature conformity

Consistent with gene/protein characterization data  Consistent with gene/protein characterization data 

RNA consistency

Not done  Not done 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

115.4 115.4 115.4, 62.8, 62.1 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 1:10000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:50 1:90 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
PHF20-001
 
PHF20-003
 
PHF20-004