KPNA6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018863

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018863 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

77 

Antigen sequence

RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGE
SVITREMVEMLFSDDSDLQLATTQKFR
 

Matching transcripts

KPNA6-001 - ENSP00000362728 [100%]
KPNA6-201 - ENSP00000444930 [100%]
KPNA6-202 - ENSP00000440609 [100%]
KPNA6-002 - ENSP00000474234 [92%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:20 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.6, 60.0, 59.7, 21.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
KPNA6-001
 
KPNA6-002
 
KPNA6-201
 
KPNA6-202