KCNG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039530

 

Antibody HPA040024

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039530 HPA040024 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

40 45 

Antigen sequence

MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY
 
ELKQEQERVMFRRAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN
 

Matching transcripts

KCNG1-001 - ENSP00000394093 [100%]
KCNG1-002 - ENSP00000360626 [100%]
KCNG1-003 - ENSP00000408116 [100%]
KCNG1-004 - ENSP00000394075 [100%]
KCNG1-005 - ENSP00000396058 [100%]
KCNG1-201 - ENSP00000379338 [100%]
 KCNG1-002 - ENSP00000360626 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:200 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 

Antibody dilution

1:26 1:43 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

57.9, 31.2, 29.5, 20.9, 11.0, 5.4 57.9 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:30000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KCNG1-001
 
KCNG1-002
 
KCNG1-003
 
KCNG1-004
 
KCNG1-005
 
KCNG1-201