RNF19A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023652

 

Antibody CAB011455

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA023652 ab10889 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

60  

Antigen sequence

EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMT
CHHRSCVDCL
 
 

Matching transcripts

RNF19A-001 - ENSP00000342667 [100%]
RNF19A-003 - ENSP00000428968 [100%]
RNF19A-009 - ENSP00000431077 [100%]
RNF19A-012 - ENSP00000429549 [95%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic and nuclear positivity in bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:30 1:500 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

90.7, 18.5, 17.4 90.7, 18.5, 17.4, 12.5, 10.0, 6.5, 1.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RNF19A-001
 
RNF19A-003
 
RNF19A-009
 
RNF19A-012