SLC18A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007210

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007210 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEES
VPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI
 

Matching transcripts

SLC18A1-001 - ENSP00000276373 [100%]
SLC18A1-002 - ENSP00000265808 [100%]
SLC18A1-003 - ENSP00000429664 [100%]
SLC18A1-004 - ENSP00000428001 [100%]
SLC18A1-005 - ENSP00000428999 [100%]
SLC18A1-008 - ENSP00000371021 [100%]
SLC18A1-201 - ENSP00000413361 [100%]
SLC18A1-202 - ENSP00000387549 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

56.3, 52.7, 50.0, 41.2, 27.7 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SLC18A1-001
 
SLC18A1-002
 
SLC18A1-003
 
SLC18A1-004
 
SLC18A1-005
 
SLC18A1-008
 
SLC18A1-201
 
SLC18A1-202