ARHGEF5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020980

 

Antibody HPA029504

 

Antibody HPA044188

 

Antibody HPA045619

 

Antibody HPA045699

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020980 HPA029504 HPA044188 HPA045619 HPA045699 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 6 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

74 94 102 77 84 

Antigen sequence

PAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSG
RPPGDSSGQAVAPSEGANKHKGWS
 
NLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMPREELDLLECYNS
PQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDG
 
QGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQEDHGIKEKGVPV
SGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCDL
FP
 
GSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQTRYYSPCEEHPAET
NQNEGAESGTIRQGEELPSEELQESQG
 
HPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQ
KQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWE
 

Matching transcripts

ARHGEF5-001 - ENSP00000056217 [100%]
ARHGEF5-002 - ENSP00000418745 [100%]
 ARHGEF5-001 - ENSP00000056217 [100%]
ARHGEF5-005 - ENSP00000418227 [100%]
 ARHGEF5-001 - ENSP00000056217 [100%]
 ARHGEF5-001 - ENSP00000056217 [97%]
 ARHGEF5-001 - ENSP00000056217 [100%]
 

Other gene match

  ARHGEF35 - ENSG00000213214 [100%]
 ARHGEF35 - ENSG00000213214 [100%]
 ARHGEF35 - ENSG00000213214 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human hippocampus shows strong nuclear and cytoplasmic positivity in neurons.
More information
 Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells while the intercalated ducts displayed slightly stronger staining.
More information
 Immunohistochemical staining of human duodenum shows moderate positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:200 1:500 1:250 1:350 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data No avaliable characterization data No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done Not done Not done Not done 

         Western Blot

Image

     

Description

  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

176.8, 89.1 176.8, 60.1 176.8, 53.3 176.8, 53.3 176.8, 53.3 

Antibody dilution

1:250 1:250 1:250 1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:12000 1:6000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF5-001
 
ARHGEF5-002
 
ARHGEF5-005