BCAR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042282

 

Antibody CAB000443

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA042282 MS-855 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

102  

Antigen sequence

SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPP
SAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDE
YD
 
 

Matching transcripts

BCAR1-001 - ENSP00000377074 [100%]
BCAR1-002 - ENSP00000162330 [100%]
BCAR1-003 - ENSP00000392708 [100%]
BCAR1-004 - ENSP00000443841 [100%]
BCAR1-005 - ENSP00000391669 [100%]
BCAR1-008 - ENSP00000377072 [100%]
BCAR1-009 - ENSP00000440415 [100%]
BCAR1-201 - ENSP00000442161 [100%]
BCAR1-017 - ENSP00000454702 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:1600 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli, plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:108 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.9, 95.5, 95.2, 93.4, 93.3, 93.1, 90.1, 25.5 97.9, 95.5, 95.2, 93.4, 93.3, 93.1, 90.1, 77.7, 25.5, 14.4, 14.2, 13.8, 12.8, 8.5, 6.2, 5.7, 5.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BCAR1-001
 
BCAR1-002
 
BCAR1-003
 
BCAR1-004
 
BCAR1-005
 
BCAR1-008
 
BCAR1-009
 
BCAR1-017
 
BCAR1-201