ATP11B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036237

 

Antibody HPA036238

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036237 HPA036238 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

98 76 

Antigen sequence

MKYQEINGRLVPEGPTPDSSEGNLSYLSSLSHLNNLSHLTTSSSFRTSPE
NETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEY
 
ETAVSVSLSCGHFHRTMNILELINQKSDSECAEQLRQLARRITEDHVIQH
GLVVDGTSLSLALREHEKLFMEVCRN
 

Matching transcripts

ATP11B-001 - ENSP00000321195 [100%]
ATP11B-004 - ENSP00000418421 [100%]
 ATP11B-001 - ENSP00000321195 [100%]
ATP11B-004 - ENSP00000418421 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows moderate cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:500 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in microtubule organizing center.
More information
 Application not done for this antibody. 

Antibody dilution

1:108  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

134.2, 111.0 134.2, 111.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATP11B-001
 
ATP11B-004