GUCY1B3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020870

 

Antibody CAB010890

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA020870 G4530 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

144  

Antigen sequence

HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAAS
KVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHD
HLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
 
 

Matching transcripts

GUCY1B3-007 - ENSP00000264424 [100%]
GUCY1B3-010 - ENSP00000420842 [100%]
GUCY1B3-003 - ENSP00000426786 [87%]
GUCY1B3-004 - ENSP00000426319 [86%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:40 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

73.1, 70.5, 68.2, 66.7 73.1, 70.5, 68.2, 67.5, 66.7, 62.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
  

Antibody dilution

1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GUCY1B3-003
 
GUCY1B3-004
 
GUCY1B3-007
 
GUCY1B3-010