SEZ6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007703

 

Antibody HPA011777

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007703 HPA011777 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

113 124 

Antigen sequence

GNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPV
YDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYE
PFVKYGNFSSSTP
 
PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKW
SDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLK
GQASIKCVPGHPSHWSDPPPICRA
 

Matching transcripts

SEZ6-001 - ENSP00000353440 [100%]
SEZ6-002 - ENSP00000312942 [100%]
SEZ6-003 - ENSP00000437650 [100%]
SEZ6-012 - ENSP00000403784 [100%]
SEZ6-201 - ENSP00000337407 [100%]
SEZ6-013 - ENSP00000443589 [81%]
 SEZ6-001 - ENSP00000353440 [100%]
SEZ6-002 - ENSP00000312942 [100%]
SEZ6-003 - ENSP00000437650 [100%]
SEZ6-012 - ENSP00000403784 [100%]
SEZ6-201 - ENSP00000337407 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong nuclear membrane and cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human hippocampus shows cytoplasmic positivity in neurons.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:25 

Literature conformity

Consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line SH-SY5Y shows positivity in intermediate filaments.
More information
 

Antibody dilution

 1:19 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

107.5, 107.4, 106.0, 99.7, 13.9 107.5, 107.4, 106.0, 99.7 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SEZ6-001
 
SEZ6-002
 
SEZ6-003
 
SEZ6-012
 
SEZ6-013
 
SEZ6-201