SEZ6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007703

 

Antibody HPA011777

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007703 HPA011777 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

113 124 

Antigen sequence

GNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPV
YDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYE
PFVKYGNFSSSTP
 
PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKW
SDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLK
GQASIKCVPGHPSHWSDPPPICRA
 

Matching transcripts

SEZ6-001 - ENSP00000353440 [100%]
SEZ6-002 - ENSP00000312942 [100%]
SEZ6-003 - ENSP00000437650 [100%]
SEZ6-012 - ENSP00000403784 [100%]
SEZ6-006 - ENSP00000440764 [81%]
SEZ6-013 - ENSP00000443589 [81%]
 SEZ6-001 - ENSP00000353440 [100%]
SEZ6-002 - ENSP00000312942 [100%]
SEZ6-003 - ENSP00000437650 [100%]
SEZ6-012 - ENSP00000403784 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong nuclear membrane and cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human hippocampus shows cytoplasmic positivity in neurons.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:25 

Literature conformity

Not done Not done 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

107.5, 107.4, 106.0, 99.7, 48.4, 13.9 107.5, 107.4, 106.0, 99.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SEZ6-001
 
SEZ6-002
 
SEZ6-003
 
SEZ6-006
 
SEZ6-012
 
SEZ6-013